DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33679

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:169 Identity:41/169 - (24%)
Similarity:70/169 - (41%) Gaps:30/169 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSEPNIVYKLKNIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILKKDY 69
            :.|.:...:|.|::|.:. ..|.....|.::.:......|.:.|.||: |:..:.:||...:|  
  Fly    12 IGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVRFITYRK-- 74

  Fly    70 SNKFQPFLVDVVINMCDALS-----------RRSFIPYGLIILKIARTFSNFNHSCPYRGHLMAR 123
            .|.:.|||.:|....|..|.           ..:|:|           |||.||:|||...:..|
  Fly    75 LNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMP-----------FSNINHTCPYNDDIYIR 128

  Fly   124 GAYLNESYLPNV-FPLGFYKFNITI---MENYITPPSAH 158
            ...|::.....| .|.|.||..:.:   :.|:|:..:.|
  Fly   129 NCTLDDRMFAKVPLPKGSYKLTLEMDDGVVNWISIINIH 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 26/101 (26%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:461928 24/91 (26%)

Return to query results.
Submit another query.