DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33914

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:179 Identity:40/179 - (22%)
Similarity:76/179 - (42%) Gaps:54/179 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NIVYKLKNIECSTVPGFSANASCHIRAINWNKAVAEMDVYLLRPLY-NITIRFQILKK-----DY 69
            |:..:.|::..|.|      ..|.:..::.||....:...:|:|:: ||.|.||::.:     ..
  Fly    30 NVTCESKDLSMSIV------EYCAVTTLSKNKNSISLRYAMLKPMFTNIEIYFQLMTRGSESIHA 88

  Fly    70 SNKFQPFLVDVVINMC-------DALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYL 127
            ::.:||||..:.:::|       :.|:|        ::.:.....:|.||:|||     .:..|:
  Fly    89 ASNWQPFLHTMKLDLCRFWKNHHNHLAR--------MVFEFIDGHTNMNHTCPY-----TKEKYI 140

  Fly   128 NESYLPNV----------FPLGFYKF-------NIT-IMENY----ITP 154
            :...|.|.          .|.|||..       ||| ::.|:    |:|
  Fly   141 SIDDLTNTEVSAKIRGVPMPKGFYALFTTWSTENITRVVTNFYFEVISP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 26/111 (23%)
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928 20/90 (22%)

Return to query results.
Submit another query.