DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33928

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster


Alignment Length:144 Identity:38/144 - (26%)
Similarity:67/144 - (46%) Gaps:17/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILKKDYSNKFQPFLVDV 80
            ||:|::: ..||....|.::|.|.......:.|.|.: |:::.|:...:.|:  ||...||..:.
  Fly    31 NIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTVNLGLHKR--SNGLMPFNQNF 93

  Fly    81 VINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGA---YLNE---SYLPNVFPLG 139
            ..:.|..::... .|..|.:..:.:.:||.||||||...::....   ::|:   .|:|  .|.|
  Fly    94 TFDGCKMVANVG-NPMVLFLFALFKPYSNINHSCPYTHDIIVDKLPTHFVNQQFTKYVP--LPEG 155

  Fly   140 FYKFNITIMENYIT 153
            .|.||    .|:.|
  Fly   156 DYVFN----SNWFT 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 23/87 (26%)
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 22/82 (27%)

Return to query results.
Submit another query.