DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33687

DIOPT Version :9

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster


Alignment Length:141 Identity:41/141 - (29%)
Similarity:66/141 - (46%) Gaps:28/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NIECSTVPGFSAN-ASCHIRAINWNKAVAEMD--VYLLRPLYNITIRFQILKKDYSNKFQPFLVD 79
            |::|..:.....| ..|.|:|:|......:::  :|:| |:.||.|:..  .|.|:|.::||.:.
  Fly    16 NLKCEMIDRTFGNFEMCRIKAVNRTHKYIDINLKLYIL-PINNIMIKLD--SKRYTNGYRPFFMS 77

  Fly    80 VVINMCDAL---SRRSFIPYGLIILKIARTF---SNFNHSCPYRGHLMA--------RGAYLNES 130
            :..:.|..|   ::||.|    .:.:|..||   ||.||:|||...:..        ..|:|.  
  Fly    78 LTFDFCKYLKNPNQRSMI----FLKEIHSTFINASNLNHTCPYNNDITVNKFWTGNLERAFLR-- 136

  Fly   131 YLPNVFPLGFY 141
            |||  .|.|.|
  Fly   137 YLP--VPNGDY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 25/83 (30%)
CG33687NP_001027130.2 DUF1091 64..147 CDD:284008 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
33.010

Return to query results.
Submit another query.