DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33798

DIOPT Version :9

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:168 Identity:44/168 - (26%)
Similarity:75/168 - (44%) Gaps:23/168 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFQLSEPNIVYKLKNIECSTVP-GFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILK 66
            ||.:.:.:.:.::.|.||.::. .||....|.::::|.......:.|:|.: |:..|.:...|.|
  Fly    11 IFLIRKVHSLVEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVNQIKVNTAIYK 75

  Fly    67 KDYSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNES- 130
            :  .|.::|||.:|.::.|..:..::..|....|..:.:..:|.|||||| .|.:.......|| 
  Fly    76 R--LNGYKPFLYNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPY-DHDIIMEKLSAESI 137

  Fly   131 ------YLPNVFPLG---------FYKFNITIMENYIT 153
                  .||  ||.|         .|..|..|:..|||
  Fly   138 NFQITKILP--FPEGKYMVKMNWFAYDINRAIIRLYIT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 28/97 (29%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 25/89 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472539
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.