DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33798

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:168 Identity:44/168 - (26%)
Similarity:75/168 - (44%) Gaps:23/168 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFQLSEPNIVYKLKNIECSTVP-GFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILK 66
            ||.:.:.:.:.::.|.||.::. .||....|.::::|.......:.|:|.: |:..|.:...|.|
  Fly    11 IFLIRKVHSLVEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVNQIKVNTAIYK 75

  Fly    67 KDYSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNES- 130
            :  .|.::|||.:|.::.|..:..::..|....|..:.:..:|.|||||| .|.:.......|| 
  Fly    76 R--LNGYKPFLYNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPY-DHDIIMEKLSAESI 137

  Fly   131 ------YLPNVFPLG---------FYKFNITIMENYIT 153
                  .||  ||.|         .|..|..|:..|||
  Fly   138 NFQITKILP--FPEGKYMVKMNWFAYDINRAIIRLYIT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 28/97 (29%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:461928 25/89 (28%)

Return to query results.
Submit another query.