DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33643

DIOPT Version :9

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:153 Identity:32/153 - (20%)
Similarity:60/153 - (39%) Gaps:40/153 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VYKLKNIE---CSTVPGFSANAS---CHIRAINWNKAVAEMD----VYLLRPLYNITIRFQILKK 67
            ::..|.||   |..  ..|:|.|   ||:..   |:.|.:.|    :..:||             
  Fly    34 IFDTKTIETLGCQV--DQSSNRSYVNCHMLL---NREVGKFDARNVLDFVRP------------- 80

  Fly    68 DYSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNF-NHSCPYRGHL--MARGAYLNE 129
               |..:..|.:..::.|..|..   |....::...::||..| |..||.:.:.  ..:..|::|
  Fly    81 ---NGQEMKLYEGRLDACLLLGS---IQKNRLVNIYSKTFKRFSNVECPLKANFNYTMKNLYMDE 139

  Fly   130 SYLPNVFPLGFYKFNITIMENYI 152
            ...|:..|.|.::   :::|.|:
  Fly   140 QDFPSFVPSGTFR---SLIEFYL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 17/83 (20%)
CG33643NP_001027258.1 DUF1091 75..152 CDD:284008 18/95 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.