DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33752

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:140 Identity:32/140 - (22%)
Similarity:62/140 - (44%) Gaps:14/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NIECSTV-PGFSANASCHIRAINWNKAVAEMDVY---LLRPLYNITIRFQILKKDYSNKFQPFLV 78
            |::|..: ..|:....|.:..:  .:.:....||   |..|:..|::.|.:.||  .:.:.|||.
  Fly    28 NVKCEVLDKSFAEFPVCKLNVL--GRGIIAESVYMKFLKLPIKKISVNFTVYKK--LSGYHPFLF 88

  Fly    79 DVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYR-----GHLMARGAYLNESYLPNV-FP 137
            :|.::.|..:...:.:..........:.:|||||||||.     ..::.:...|.::....: .|
  Fly    89 NVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLTDTMFAKIPLP 153

  Fly   138 LGFYKFNITI 147
            .|.|.|:|.:
  Fly   154 TGNYMFSIKL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 20/81 (25%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:461928 21/88 (24%)

Return to query results.
Submit another query.