DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33654

DIOPT Version :9

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster


Alignment Length:134 Identity:27/134 - (20%)
Similarity:54/134 - (40%) Gaps:25/134 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YKLKNIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDYSNKFQPFL 77
            ::..|::|::. ..|.....|:||:.|             |....:|::..:.|....|.::||:
  Fly    26 FEFTNLQCTSFDKSFDDFEYCYIRSAN-------------RSYKYLTLKVNLFKTPRFNGYRPFM 77

  Fly    78 VDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLPNVFPLGFYK 142
            .::.::.|..|......|......:...::||.|||||:           |...:.:..|:.|..
  Fly    78 FNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPF-----------NHDLIVDKIPIDFVN 131

  Fly   143 FNIT 146
            ..:|
  Fly   132 HRVT 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 16/74 (22%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.