DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33703

DIOPT Version :9

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster


Alignment Length:150 Identity:33/150 - (22%)
Similarity:78/150 - (52%) Gaps:14/150 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VYKLKNIECSTV-PGFSANASCH-IRAINWNKAVAEMDVYLLR-PLYNITIRFQILKKDYSNKFQ 74
            |:::..:||.:: |.|:...:|. :|..|...|:...:|:|.: |:.:|.:...:.:...:.:||
  Fly    23 VFRVSKMECRSLDPSFTYFKTCKVVRRENGRAALYVSEVFLYKDPIDDIVLNLGVFRIAKNRRFQ 87

  Fly    75 PFLVDVVINMCDALSRRSFIP---YGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLPNV- 135
              .::..::.|  |..|.::.   :|.::..:.| .||.|.:||.:.::...|..::|:.:..: 
  Fly    88 --FLNETLDYC--LFSRQYLASGFFGFLMTPLLR-ISNLNATCPLQQNITFNGFSVDENTIKEIP 147

  Fly   136 FPLGFYKFNI--TIMENYIT 153
            .|.|.|.|::  ::|:.:.|
  Fly   148 IPNGVYMFHLRSSLMKKWRT 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 19/86 (22%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 17/86 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.