DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG14491

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster


Alignment Length:113 Identity:26/113 - (23%)
Similarity:46/113 - (40%) Gaps:27/113 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NIECST--VPGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQ------------ILKKD 68
            |..||:  ..|..:...|.:     :|:|.       ||.:||.::|:            :|.:.
  Fly     5 NCSCSSEDPEGMLSLLKCGL-----SKSVK-------RPSFNIELQFKKPVAKFFVNMRIVLPRR 57

  Fly    69 YSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPY 116
            :.:.|..|.:. .|:.|..||.::.|.:..:..|....|||....||:
  Fly    58 FGDDFTLFNLS-GIDGCSLLSNKNQIAFIQLGRKHMDRFSNIPKRCPW 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 13/44 (30%)
CG14491NP_611276.1 DM8 60..150 CDD:214778 13/46 (28%)

Return to query results.
Submit another query.