DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG14492

DIOPT Version :9

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:195 Identity:44/195 - (22%)
Similarity:73/195 - (37%) Gaps:49/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FQLSEPNIVYKLKNIECSTVPGFSANASCHIRAINWN------KAVAEMDVYL------LRPLYN 57
            |:|...|......:|..|.:..|:...|...:...|:      :.|||.|.::      .|||.:
  Fly    32 FELQTDNFTCSSDDISSSVLKEFTCGISKSTKRRTWHMEFVLEQPVAEHDFFIKIVLPRRRPLPD 96

  Fly    58 ITIRFQILKKDYSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHL-- 120
            ..                 |::|..:.|..|:.|:.:|...:...|...||||...||::.:.  
  Fly    97 FV-----------------LLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFKPNFTY 144

  Fly   121 MARGAYLNESYLPNVFPLGFYKFNITIMENYITPPSAHVG---GIIW---YVQA-MHAIQPKKKT 178
            ..||..|:.:.:|.|           .||..:....:|..   ||.|   |:.| :..|..||::
  Fly   145 YIRGFRLDLNLVPAV-----------DMETPVQIEFSHQNKQQGIRWITGYLMARVQRISEKKRS 198

  Fly   179  178
              Fly   199  198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 23/95 (24%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 25/118 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.