DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG13193

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:176 Identity:42/176 - (23%)
Similarity:66/176 - (37%) Gaps:45/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DIFQLS------EPNIVYKLKNIE-------CSTVPGFSANASCHIRAINWNKAVAE--MDVYLL 52
            |:.|:.      .|.:..|..||.       ||::.|             |..|..|  :|::|.
  Fly    18 DLIQIQISALRFGPTLRSKFTNISVECSKDYCSSIRG-------------WLTAKGELNLDIHLN 69

  Fly    53 RPLYN-----ITIRFQILKKDYSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTF--SNF 110
            |.|.|     ||: .|::  |..:::|. |....::.|..|  |..:...|:.:.:...|  .|.
  Fly    70 RTLKNGLRTTITL-LQLI--DGKDRYQT-LFSYDMDTCKTL--RELLQSSLMKVWLRNVFKYGNL 128

  Fly   111 NHSCPYR-GHLMARGAYLNESYLPNVFPLGFYKFNITIMENYITPP 155
            ...||.: .....|...|....:|...|.|||:.:.|   ||...|
  Fly   129 ADRCPIQPASYDVRNFQLENHSIPGYLPAGFYRLHDT---NYYGKP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 21/86 (24%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 21/87 (24%)

Return to query results.
Submit another query.