DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33467

DIOPT Version :9

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:174 Identity:67/174 - (38%)
Similarity:106/174 - (60%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFQLSEPNIVYKLKNIECSTVPGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKD 68
            |..:::..:|||...:||........|.||:::.||||.|:..:|.||:.||.|.|||.|:..||
  Fly    14 IGHMTDSQLVYKFTKVECQGNQARVKNVSCNVKPINWNTALVNLDCYLIYPLINPTIRVQVFMKD 78

  Fly    69 YSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLP 133
            |||:::|||:|....:||.:.|::|:||.:::.::.:.|:|.. ||...|.|.||..|||.||:|
  Fly    79 YSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SCHISGQLSARNGYLNSSYVP 142

  Fly   134 NVFPLGFYKFNITIMENYITPPSAHVGGIIWYVQAMHAIQPKKK 177
             .||.|.|:.::...::..| ....||.:.::||||..|:.||:
  Fly   143 -PFPHGQYQISVMFSDSNST-NREFVGIVKFFVQAMDEIKIKKR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 31/90 (34%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 36/82 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471921
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014288
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.