DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt-I and HEM1

DIOPT Version :9

Sequence 1:NP_610842.1 Gene:Spt-I / 36448 FlyBaseID:FBgn0086532 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_010518.1 Gene:HEM1 / 851818 SGDID:S000002640 Length:548 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:77/277 - (27%)
Similarity:125/277 - (45%) Gaps:34/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SHNYLGFLEDQEILEEACKSLRKYGVGSCGPRGFYGTMDVHLDLEDRIAKFMGLEEAIVYS--YG 163
            |::||...:..|:|:...|::.|||.|:.|.|...|.....|:||..:|.....|.|:|:|  |.
Yeast   120 SNDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYV 184

  Fly   164 FSTVASAIPAYAKRGDLIFVDEAVNFAIQKGLDASRSTIVFFKHNDVEDLERLLIEQEKRDQKNP 228
            .:....::.....:..:||.||..:.::..|:..:......|||||:.:||:||       |..|
Yeast   185 ANDAVLSLLGQKMKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLL-------QSYP 242

  Fly   229 KKAAKTRRFLVAEGIYMNTGEICPLPDLVALRQKYKLRLFIDESISFGTLGQGGHGVTEHFNVD- 292
            |...|...|   |.:|...|.:..:..:..|..||....|:||..:.|..|..|.||.||.:.: 
Yeast   243 KSVPKLIAF---ESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFES 304

  Fly   293 --------------------RDEVDLISAGMEGSMATVGGFCVGSHFIAEHQRLSGLGYIFSASL 337
                                .|.||:|:..:..|..:|||:...|..:.:..|....|:||:.:|
Yeast   305 HRASGIATPKTNDKGGAKTVMDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFAPGFIFTTTL 369

  Fly   338 PPMLTQAAISALDRFER 354
            ||.:...|.:|: |::|
Yeast   370 PPSVMAGATAAI-RYQR 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt-INP_610842.1 AAT_I 22..468 CDD:302748 77/277 (28%)
BioF 79..463 CDD:223234 77/277 (28%)
HEM1NP_010518.1 5aminolev_synth 71..492 CDD:273820 77/277 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.