DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt-I and alas2

DIOPT Version :9

Sequence 1:NP_610842.1 Gene:Spt-I / 36448 FlyBaseID:FBgn0086532 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_571757.1 Gene:alas2 / 64607 ZFINID:ZDB-GENE-001229-1 Length:583 Species:Danio rerio


Alignment Length:279 Identity:81/279 - (29%)
Similarity:135/279 - (48%) Gaps:22/279 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PLLHTRVVQSRVGKRIQVDGHDCLNLGSHNYLGFLEDQEILEEACKSLRKYGVGSCGPRGFYGTM 138
            |......:..|:|.::.|   .|    |::|||......:::....:|:|:|.|:.|.|...||.
Zfish   171 PFAEDYSIAGRLGSQVSV---WC----SNDYLGMSRHPRVVKAIGDALKKHGAGAGGTRNISGTS 228

  Fly   139 DVHLDLEDRIAKFMGLEEAIVYSYGFSTVASAIPAYAKR--GDLIFVDEAVNFAIQKGLDASRST 201
            :.|:.||:.:|:....:.|:|:|..|....|.:...||.  |..|:.|...:.::.:|:..|.:.
Zfish   229 NYHVALENELARLHQKDGALVFSSCFVANDSTLFTLAKMLPGCEIYSDMGNHASMIQGIRNSGAK 293

  Fly   202 IVFFKHNDVEDLERLLIEQEKRDQKNPKKAAKTRRFLVA-EGIYMNTGEICPLPDLVALRQKYKL 265
            ...|:|||...||.||   .:.|...||        :|| |.::...|.||||.:|..:..||..
Zfish   294 RFIFRHNDASHLEELL---SRSDPLTPK--------IVAFETVHSMDGAICPLEELCDVAHKYGA 347

  Fly   266 RLFIDESISFGTLGQGGHGVTEHFNVDRDEVDLISAGMEGSMATVGGFCVGSHFIAEHQRLSGLG 330
            ..|:||..:.|..|..|.||.|..|| ..::|::|..:..:...|||:...:..:.:..|....|
Zfish   348 LTFVDEVHAVGLYGAHGAGVGERDNV-MHKIDIVSGTLGKAFGCVGGYIASTAALVDTVRSFAAG 411

  Fly   331 YIFSASLPPMLTQAAISAL 349
            :||:.|||||:...|:.::
Zfish   412 FIFTTSLPPMVLAGALESV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt-INP_610842.1 AAT_I 22..468 CDD:302748 81/279 (29%)
BioF 79..463 CDD:223234 80/274 (29%)
alas2NP_571757.1 Preseq_ALAS 3..98 CDD:286162
AAT_I 138..542 CDD:302748 81/279 (29%)
BioF 138..535 CDD:223234 81/279 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.