DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt-I and Alas

DIOPT Version :9

Sequence 1:NP_610842.1 Gene:Spt-I / 36448 FlyBaseID:FBgn0086532 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_477281.1 Gene:Alas / 37815 FlyBaseID:FBgn0020764 Length:539 Species:Drosophila melanogaster


Alignment Length:367 Identity:95/367 - (25%)
Similarity:157/367 - (42%) Gaps:83/367 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SHNYLGFLEDQEILEEACKSLRKYGVGSCGPRGFYGTMDVHLDLEDRIAKFMGLEEAIVYSYGF- 164
            |::|||......:......:|.::|.|:.|.|...|....|..||.::|:....|.|::::..| 
  Fly   146 SNDYLGMSAHPGVKRAVQDALNRHGSGAGGTRNISGNSLHHERLESKLAELHQKEAALLFTSCFV 210

  Fly   165 ------STVASAIPAYAKRGDLIFVDEAVNFAIQKGLDASRSTIVFFKHNDVEDLERLLIEQEKR 223
                  .|:|..:|     |..||.|...:.::..|:..|......|:||||:.|.:||   ::.
  Fly   211 ANDSTLFTLAKLLP-----GCEIFSDAGNHASMIMGIRNSGVPKHIFRHNDVDHLHQLL---KQT 267

  Fly   224 DQKNPKKAAKTRRFLVA-EGIYMNTGEICPLPDLVALRQKYKLRLFIDESISFGTLGQGGHGVTE 287
            |:..||        :|| |.::..||.||||.:|:.:..::....||||..:.|..|..|.||.|
  Fly   268 DKSVPK--------IVAFETVHSMTGAICPLEELLDVAHEHGAITFIDEVHAVGLYGDHGAGVGE 324

  Fly   288 HFNVDRDEVDLISAGMEGSMATVGGFCVGSHFIAEHQRLSGLGYIFSASLPPMLTQAAISALDRF 352
            ...| ..::|:||..:..:...:||:..|:|.:.:..|....|:||:.||||.:...|:.|::  
  Fly   325 RDGV-LHKMDIISGTLGKAFGNIGGYIAGTHNLVDMIRSYAAGFIFTTSLPPTVLCGALEAVN-- 386

  Fly   353 EREPQIFEQLQAKSKTLHQKFLRFSKLTLRGDEVSPVKHLYLAQPAENFDKELKLLTELADKCIA 417
                                       .|..:|...::||:                       .
  Fly   387 ---------------------------ILASEEGRQLRHLH-----------------------Q 401

  Fly   418 RGVAVVQAAYLQNRERQPVR--PS--IRIAVNRLLESSEIDN 455
            |.|:.:::  |..||..||.  ||  |.|.:...|:||:|.|
  Fly   402 RNVSYLKS--LLKREGFPVEETPSHIIPIKIGDPLKSSQISN 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt-INP_610842.1 AAT_I 22..468 CDD:302748 95/367 (26%)
BioF 79..463 CDD:223234 95/367 (26%)
AlasNP_477281.1 AAT_I 93..495 CDD:302748 95/367 (26%)
BioF 95..490 CDD:223234 95/367 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453114
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0156
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13693
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.