DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt-I and Sptlc3

DIOPT Version :9

Sequence 1:NP_610842.1 Gene:Spt-I / 36448 FlyBaseID:FBgn0086532 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001099987.1 Gene:Sptlc3 / 296188 RGDID:1310030 Length:563 Species:Rattus norvegicus


Alignment Length:408 Identity:115/408 - (28%)
Similarity:198/408 - (48%) Gaps:45/408 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DPNHPLLHTRVVQSRVGKRIQVDGHDCLNLGSHNYLGFLED-QEILEEACKSLRKYGVGSCGPRG 133
            |.|....||       ||.|:    :.:|:.|:||||.... .|.:|:...::.|||||....|.
  Rat   147 DYNWTFRHT-------GKVIK----NVINMASYNYLGLASKYNESMEKVKDTIEKYGVGVASTRN 200

  Fly   134 FYGTMDVHLDLEDRIAKFMGLEEAIVYSYGFSTVASAIPAYAKRGDLIFVDEAVNFAIQKGLDAS 198
            ..|::|:|.:|||.:|||:.:|..:|:..||:|.::.||.:..:|.||..||..:.::..|...|
  Rat   201 EMGSLDIHNELEDLMAKFLNVEAVMVFGMGFATNSTNIPIFVGKGCLILSDEFNHTSVILGSRLS 265

  Fly   199 RSTIVFFKHNDVEDLERLLIEQEKRDQKNPKKAAKTRRFLVAEGIYMNTGEICPLPDLVALRQKY 263
            .:.|..||||::::||:||.|...|.|....:|.| :..::.||:|...|.|..||.:|||::||
  Rat   266 GAVIRPFKHNNIQNLEKLLREAIIRGQPRTGRAWK-KILILVEGVYSMEGSIVNLPQIVALKKKY 329

  Fly   264 KLRLFIDESISFGTLGQGGHGVTEHFNVDRDEVDLISAGMEGSMATVGGFCVGSHFIAEHQRLSG 328
            |..|::||:.|.|..|..|.|:.|.|.:..:::|:.......|.|..||:..|...|.::.|:..
  Rat   330 KAYLYMDEAHSIGCTGTMGQGIRELFGLAPEDIDIYMGTFTKSFAASGGYIAGKKEIVDYVRVQS 394

  Fly   329 LGYIFSASLPPMLTQAAISALD---RFERE---PQIFEQLQAKSKTLHQKFLRFSKLTLRGDEVS 387
            ....::.|:.|::....|.:|.   .:|..   .|..:||:...|...::.:... ..:.|::.|
  Rat   395 HSATYATSMSPVVAAQIIRSLKIMMGYEGNFGGVQRIQQLRENIKYFRRRLIEMG-FIIYGNDYS 458

  Fly   388 PVKHLYLAQPAENFDKELKLLTELADKCIARGVAVVQAAYLQNRERQPVRPSIRIAVNRL---LE 449
            ||..:.|..||:        ::......:.:.:|||...:          |:..:...|.   |.
  Rat   459 PVVPVLLYMPAK--------VSAFGRLLLKKKIAVVVVGF----------PATSLPEGRARFSLS 505

  Fly   450 SSE----IDNAFEVIESV 463
            |:.    :|...||::.:
  Rat   506 SAHTREMLDTVLEVVDKI 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt-INP_610842.1 AAT_I 22..468 CDD:302748 115/408 (28%)
BioF 79..463 CDD:223234 111/397 (28%)
Sptlc3NP_001099987.1 PLN02483 59..533 CDD:178101 115/408 (28%)
bioF 160..521 CDD:273303 108/384 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312139at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.