DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt-I and ALAS1

DIOPT Version :9

Sequence 1:NP_610842.1 Gene:Spt-I / 36448 FlyBaseID:FBgn0086532 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001291373.1 Gene:ALAS1 / 211 HGNCID:396 Length:657 Species:Homo sapiens


Alignment Length:376 Identity:101/376 - (26%)
Similarity:168/376 - (44%) Gaps:59/376 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HTRVVQSRVGKRIQV-----DGHDCLNLG-------SHNYLGFLEDQEILEEACKSLRKYGVGSC 129
            ||..|...|.:|..:     |..|.|...       |::|||......:......:|:::|.|:.
Human   231 HTYRVFKTVNRRAHIFPMADDYSDSLITKKQVSVWCSNDYLGMSRHPRVCGAVMDTLKQHGAGAG 295

  Fly   130 GPRGFYGTMDVHLDLEDRIAKFMGLEEAIVYSYGFSTVASAIPAYAKR--GDLIFVDEAVNFAIQ 192
            |.|...||...|:|||..:|...|.:.|:::|..|....|.:...||.  |..|:.|...:.::.
Human   296 GTRNISGTSKFHVDLERELADLHGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMI 360

  Fly   193 KGLDASRSTIVFFKHNDVEDLERLLIEQEKRDQKNPKKAAKTRRFLVA-EGIYMNTGEICPLPDL 256
            :|:..||.....|:||||..|..||   ::.|...||        :|| |.::...|.:|||.:|
Human   361 QGIRNSRVPKYIFRHNDVSHLRELL---QRSDPSVPK--------IVAFETVHSMDGAVCPLEEL 414

  Fly   257 VALRQKYKLRLFIDESISFGTLGQGGHGVTEHFNVDRD----EVDLISAGMEGSMATVGGFCVGS 317
            ..:..::....|:||..:.|..|..|.|:.     |||    ::|:||..:..:...|||:...:
Human   415 CDVAHEFGAITFVDEVHAVGLYGARGGGIG-----DRDGVMPKMDIISGTLGKAFGCVGGYIAST 474

  Fly   318 HFIAEHQRLSGLGYIFSASLPPMLTQAAISALDRFEREPQIFEQLQAK-SKTLHQKFLRFSKLTL 381
            ..:.:..|....|:||:.||||||...|:.::       :|.:..:.: .:..||:.::..:..|
Human   475 SSLIDTVRSYAAGFIFTTSLPPMLLAGALESV-------RILKSAEGRVLRRQHQRNVKLMRQML 532

  Fly   382 RGDEVSPVKH-------LYLAQPAENFDKELKLLTELADKCIARGVAVVQA 425
            . |...||.|       :.:|..|:|        ||:.|:.::|....|||
Human   533 M-DAGLPVVHCPSHIIPVRVADAAKN--------TEVCDELMSRHNIYVQA 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt-INP_610842.1 AAT_I 22..468 CDD:302748 101/376 (27%)
BioF 79..463 CDD:223234 99/374 (26%)
ALAS1NP_001291373.1 Preseq_ALAS 19..154 CDD:286162
AAT_I 214..619 CDD:302748 101/376 (27%)
BioF 214..605 CDD:223234 101/376 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.