DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLaz and apoda.1

DIOPT Version :9

Sequence 1:NP_001260936.1 Gene:GLaz / 36447 FlyBaseID:FBgn0033799 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001070050.2 Gene:apoda.1 / 767642 ZFINID:ZDB-GENE-060929-148 Length:185 Species:Danio rerio


Alignment Length:208 Identity:55/208 - (26%)
Similarity:90/208 - (43%) Gaps:29/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RVWLLSGVLLVTFAGTDAYGFGRCPNYPSMPKFNMSRVLGHWYEVERSFYLP-EIASG-CTTFQF 72
            :|:|:...|.:.........:|.||...:.|.||:.:.:|.|:|:.:   || :...| |....|
Zfish     2 KVFLVVLALFLPLMSAQVPHWGPCPEPATQPAFNLQKFMGRWFEIAK---LPAQFERGRCIETNF 63

  Fly    73 EPYNKGEQSKFSNFKLAVAIKNINRITGNPNVNIGYATPENSRSSI---MDFKFTTRFPDVIARL 134
            .....|.....|:..|...:|.|:          |.|..|:.|:..   :.|.:          :
Zfish    64 TLKLDGTAHVVSSEILKGELKTID----------GTAVVEDKRNPAKLGISFSY----------V 108

  Fly   135 LPGSGKYQVLYTDYENFAILWSCGSIGSLGHSDQIWILGRDRDFEVDIRSKVYDVLKRLSLDPER 199
            ||.: .|.:|.|||||.|:::||..:..|.|.|..|||||.|...........:|....::|..|
Zfish   109 LPYT-PYWILSTDYENSALVYSCTDVLRLFHVDFAWILGRTRSLPAATIEHGKEVFTSNNIDVSR 172

  Fly   200 LIISKNKQCPEAL 212
            :|:|:.:.|.:.|
Zfish   173 MILSRQQGCDQKL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLazNP_001260936.1 Lipocalin 48..202 CDD:278490 42/158 (27%)
apoda.1NP_001070050.2 Lipocalin 34..178 CDD:304412 46/167 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.