DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLaz and RBP4

DIOPT Version :10

Sequence 1:NP_523727.2 Gene:GLaz / 36447 FlyBaseID:FBgn0033799 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_006735.2 Gene:RBP4 / 5950 HGNCID:9922 Length:201 Species:Homo sapiens


Alignment Length:155 Identity:33/155 - (21%)
Similarity:57/155 - (36%) Gaps:28/155 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VWLLSGVLLVTFAGTDAYGFGRCPNYPSMPKFNMSRVLGHWY-----EVERSFYLPEIASGCT-- 68
            ||.|  :||.......|....|..::.....|:.:|..|.||     :.|..|....|.:..:  
Human     4 VWAL--LLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVD 66

  Fly    69 -TFQFEPYNKGEQSKFSNFKLAVAIKNINRITGNPNVNIGYATPENSRSSIMDFKFTTRFPDVIA 132
             |.|.....||.....:|:.:...:......|.:|                  .||..::..|.:
Human    67 ETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDP------------------AKFKMKYWGVAS 113

  Fly   133 RLLPGSGKYQVLYTDYENFAILWSC 157
            .|..|:..:.::.|||:.:|:.:||
Human   114 FLQKGNDDHWIVDTDYDTYAVQYSC 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLazNP_523727.2 lipocalin_FABP 30..204 CDD:471979 27/136 (20%)
RBP4NP_006735.2 lipocalin_RBP_like 22..192 CDD:381184 27/135 (20%)

Return to query results.
Submit another query.