DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLaz and RBP4

DIOPT Version :9

Sequence 1:NP_001260936.1 Gene:GLaz / 36447 FlyBaseID:FBgn0033799 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001310446.1 Gene:RBP4 / 5950 HGNCID:9922 Length:201 Species:Homo sapiens


Alignment Length:155 Identity:33/155 - (21%)
Similarity:57/155 - (36%) Gaps:28/155 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VWLLSGVLLVTFAGTDAYGFGRCPNYPSMPKFNMSRVLGHWY-----EVERSFYLPEIASGCT-- 68
            ||.|  :||.......|....|..::.....|:.:|..|.||     :.|..|....|.:..:  
Human     4 VWAL--LLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVD 66

  Fly    69 -TFQFEPYNKGEQSKFSNFKLAVAIKNINRITGNPNVNIGYATPENSRSSIMDFKFTTRFPDVIA 132
             |.|.....||.....:|:.:...:......|.:|                  .||..::..|.:
Human    67 ETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDP------------------AKFKMKYWGVAS 113

  Fly   133 RLLPGSGKYQVLYTDYENFAILWSC 157
            .|..|:..:.::.|||:.:|:.:||
Human   114 FLQKGNDDHWIVDTDYDTYAVQYSC 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLazNP_001260936.1 Lipocalin 48..202 CDD:278490 24/118 (20%)
RBP4NP_001310446.1 lipocalin_RBP_like 22..192 CDD:381184 27/135 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.