DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLaz and NLaz

DIOPT Version :9

Sequence 1:NP_001260936.1 Gene:GLaz / 36447 FlyBaseID:FBgn0033799 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001259867.1 Gene:NLaz / 33324 FlyBaseID:FBgn0053126 Length:245 Species:Drosophila melanogaster


Alignment Length:179 Identity:47/179 - (26%)
Similarity:72/179 - (40%) Gaps:17/179 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GRCPNYPSMPKFNMSRVLGHWYEVERSFYLPEIASGCTTFQFEPYNKGEQSKFSNFKLAVAIKNI 95
            |:||:...:..|:....:|.|||.....:..||...|....:        |...|..::|....|
  Fly    31 GKCPDVKLLDTFDAEAYMGVWYEYAAYPFAFEIGKKCIYANY--------SLIDNSTVSVVNAAI 87

  Fly    96 NRITGNPNVNIGYATPENSRSSIMDFKFTTRFPDVIARLLPGSGKYQVLYTDYENFAILWSCGSI 160
            ||.||.|:...|.|.........:.|..|....         ...|.||.||||::|:::||.|:
  Fly    88 NRFTGQPSNVTGQAKVLGPGQLAVAFYPTQPLT---------KANYLVLGTDYESYAVVYSCTSV 143

  Fly   161 GSLGHSDQIWILGRDRDFEVDIRSKVYDVLKRLSLDPERLIISKNKQCP 209
            ..|.:...:|||.|.|:...:.......:|:...:....||.:..|.||
  Fly   144 TPLANFKIVWILTRQREPSAEAVDAARKILEDNDVSQAFLIDTVQKNCP 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLazNP_001260936.1 Lipocalin 48..202 CDD:278490 39/153 (25%)
NLazNP_001259867.1 Lipocalin 36..164 CDD:304412 38/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3040
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132210at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.