DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLaz and Karl

DIOPT Version :9

Sequence 1:NP_001260936.1 Gene:GLaz / 36447 FlyBaseID:FBgn0033799 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster


Alignment Length:250 Identity:54/250 - (21%)
Similarity:92/250 - (36%) Gaps:82/250 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PLGSRVWLLSGVLLVTFAGTDAY-------GFGRCPNYPSMPKFNMSRVLGHWYEVERSFY---- 59
            |:|:.:|        |...::||       ...|||...::..|::.|::|.|:.|:  :|    
  Fly    27 PVGANLW--------TRHNSNAYQTRRRSGPSNRCPKVGAIKNFDLERMMGCWHVVQ--YYASTE 81

  Fly    60 -LPEIASGCTTFQFEPYNKGEQSKFSNFKLAVAIKNI-NRITGNPNVNIGYATPENSRSSIMDFK 122
             |||.|  |....|. ::|.:|....||....|...: .::.|    ||.:..|           
  Fly    82 ELPEYA--CMRSHFS-FSKEDQHITMNFSYIFAEDPLREKLVG----NITWMIP----------- 128

  Fly   123 FTTRFPDVIARLLPG---------SGKYQ--VLYTDYENFAILWSCGS---------------IG 161
               :|.:      ||         .|.|.  ||.|||:.:.::..|..               ..
  Fly   129 ---KFQE------PGHWQHTEDIYEGIYNTYVLDTDYDTWGLVMHCAEKKKQPRYLSALLLSRKT 184

  Fly   162 SLGHSDQIWILGR-----DRDFEVDIRSKVYDVLKRLSL-DPERLIISKNKQCPE 210
            ||..::..::.|:     |..|..:|..:..|.|...|. ||...:::..|:..|
  Fly   185 SLADNEISFLRGKLPQDIDTSFMFNIGQESCDNLMESSRDDPLAYVVNGRKRAKE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLazNP_001260936.1 Lipocalin 48..202 CDD:278490 41/191 (21%)
KarlNP_001285137.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.