DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLaz and CG31659

DIOPT Version :9

Sequence 1:NP_001260936.1 Gene:GLaz / 36447 FlyBaseID:FBgn0033799 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_722702.1 Gene:CG31659 / 318875 FlyBaseID:FBgn0051659 Length:192 Species:Drosophila melanogaster


Alignment Length:131 Identity:38/131 - (29%)
Similarity:56/131 - (42%) Gaps:22/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GRCP-NYPSMPKFNMSRVLGHWYEVERSFYLPEIASGCTTFQFEPYNKGEQSKFSNFKLAVAIKN 94
            |.|| |..::...:|.|..|.||  ..|.| |.::......|...:.:.|::|||     |..:.
  Fly    25 GACPSNMTAVGDLDMDRFKGKWY--THSIY-PHLSLRVEKCQSTDFIEKEENKFS-----VVARE 81

  Fly    95 INRITGNPNV---NIGYATPENSRSSIMDFKFTTRFPDVIARLLPGSGKYQVLYTDYENFAILWS 156
            :|..||...:   :|....||..|..:  ...:|.||:.:.        ..||.|||.||||.:.
  Fly    82 LNTQTGTVKMRKADILNVEPEFGRYVL--GTTSTAFPEGVL--------MYVLDTDYVNFAIRFM 136

  Fly   157 C 157
            |
  Fly   137 C 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLazNP_001260936.1 Lipocalin 48..202 CDD:278490 32/113 (28%)
CG31659NP_722702.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3040
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.