DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLaz and Apod

DIOPT Version :9

Sequence 1:NP_001260936.1 Gene:GLaz / 36447 FlyBaseID:FBgn0033799 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_038943926.1 Gene:Apod / 25239 RGDID:2137 Length:204 Species:Rattus norvegicus


Alignment Length:205 Identity:56/205 - (27%)
Similarity:92/205 - (44%) Gaps:30/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLLVTFAG----TDAYGF--GRCPNYPSMPKFNMSRVLGHWYEVERSFYLPEIASGCTTFQFEPY 75
            :||.|.||    |:...|  |:||:.|....|::.:.||.|||:|:   :|        ..||..
  Rat    21 LLLATLAGLFTTTEGQSFHLGKCPSPPVQENFDVKKYLGRWYEIEK---IP--------VSFEKG 74

  Fly    76 N--KGEQSKFSNFKLAVAIKNINRITGNPNVNIGYATPEN-SRSSIMDFKFTTRFPDVIARLLPG 137
            |  :...|...|..:.|..|.: |..|..|...|.|...| |..:.::.:|.:..|         
  Rat    75 NCIQANYSLMENGNIKVLNKEL-RPDGTLNQVEGEAKQSNMSEPAKLEVQFFSLMP--------- 129

  Fly   138 SGKYQVLYTDYENFAILWSCGSIGSLGHSDQIWILGRDRDFEVDIRSKVYDVLKRLSLDPERLII 202
            ...|.:|.||||::|:::||.:.....|.|.:|||||:.....:..:.:..:|....:|..::..
  Rat   130 PAPYWILATDYESYALVYSCTTFFWFFHVDYVWILGRNPYLPPETITYLKYILTSNDIDIAKITT 194

  Fly   203 SKNKQCPEAL 212
            :....||:.|
  Rat   195 TDQANCPDFL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLazNP_001260936.1 Lipocalin 48..202 CDD:278490 41/156 (26%)
ApodXP_038943926.1 lipocalin_apoD-like 40..197 CDD:381212 46/177 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10612
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.