DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLaz and Apod

DIOPT Version :9

Sequence 1:NP_001260936.1 Gene:GLaz / 36447 FlyBaseID:FBgn0033799 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001288282.1 Gene:Apod / 11815 MGIID:88056 Length:189 Species:Mus musculus


Alignment Length:205 Identity:62/205 - (30%)
Similarity:97/205 - (47%) Gaps:30/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLLVTFAG--TDAYG----FGRCPNYPSMPKFNMSRVLGHWYEVERSFYLPEIASGCTTFQFEPY 75
            :.|.|.||  |.|.|    .|:||:.|....|::.:.||.|||:|:   :|.        .||..
Mouse     6 MFLATLAGLFTTAKGQNFHLGKCPSPPVQENFDVKKYLGRWYEIEK---IPA--------SFEKG 59

  Fly    76 N--KGEQSKFSNFKLAVAIKNINRITGNPNVNIGYATPEN-SRSSIMDFKFTTRFPDVIARLLPG 137
            |  :...|...|..:.|..|.::. .|..|...|.|...| |..:.::.:|   ||     |:| 
Mouse    60 NCIQANYSLMENGNIEVLNKELSP-DGTMNQVKGEAKQSNVSEPAKLEVQF---FP-----LMP- 114

  Fly   138 SGKYQVLYTDYENFAILWSCGSIGSLGHSDQIWILGRDRDFEVDIRSKVYDVLKRLSLDPERLII 202
            ...|.:|.|||||:|:::||.:...|.|.|.:|||||:.....:..:.:.|:|....:|.|::..
Mouse   115 PAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTT 179

  Fly   203 SKNKQCPEAL 212
            :....||:.|
Mouse   180 TDQANCPDFL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLazNP_001260936.1 Lipocalin 48..202 CDD:278490 47/156 (30%)
ApodNP_001288282.1 Lipocalin 37..182 CDD:304412 48/165 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.