DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLaz and apoda.2

DIOPT Version :9

Sequence 1:NP_001260936.1 Gene:GLaz / 36447 FlyBaseID:FBgn0033799 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001188277.1 Gene:apoda.2 / 100148022 ZFINID:ZDB-GENE-070912-551 Length:189 Species:Danio rerio


Alignment Length:199 Identity:52/199 - (26%)
Similarity:90/199 - (45%) Gaps:31/199 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLLVTFAGTDAYGFGRCPNYPSMPKFNMSRVLGHWYEVERSFYLPEIASGCTTFQFEPYNKGE-- 79
            :|.|......:.|.|:||..|....|:.:|.:|.|:|:.:   .|           .|:..||  
Zfish    11 LLAVLAVSAQSIGSGKCPQPPVQKDFDPTRYMGRWHEIMK---FP-----------SPFQLGECC 61

  Fly    80 QSKFSNFKLAVAIKNINRITGNPNVNIGYATP---ENSRSSIMDFKFTTRFPDVIARLLPGSGKY 141
            |:.::.....|.::| :.|..|..::....|.   :.|..:.::..|   |.|.     |.| .|
Zfish    62 QATYTLSDGIVLVRN-DEILSNGTISFIEGTAKIVDASEPAKLEVSF---FEDA-----PPS-PY 116

  Fly   142 QVLYTDYENFAILWSCGSIGSLGHSDQIWILGRDRDFEVDIRSKVYDVLKRLSLDPERLIISKNK 206
            .||.|||:::.:::||...|:|.|::..|||.|.|....:..|::.|:||...:..|  ..::..
Zfish   117 WVLATDYDDYTLVYSCTDFGNLFHAEYSWILSRSRTLNKETISELLDILKSHGIGTE--AFTETD 179

  Fly   207 QCPE 210
            |.||
Zfish   180 QRPE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLazNP_001260936.1 Lipocalin 48..202 CDD:278490 40/158 (25%)
apoda.2NP_001188277.1 Lipocalin 36..180 CDD:304412 42/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.