DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and Plg

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_445943.1 Gene:Plg / 85253 RGDID:619893 Length:812 Species:Rattus norvegicus


Alignment Length:267 Identity:70/267 - (26%)
Similarity:92/267 - (34%) Gaps:90/267 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EENGYCA--PYSGKVCKEY--LTGQVWYSLEDPTGGWKNEQVTTALWDELISDLTGLCREAAEKM 125
            ||..||:  .|.||:.|..  |..|.|.|......|:                            
  Rat   183 EECMYCSGEKYEGKISKTMSGLDCQSWDSQSPHAHGY---------------------------- 219

  Fly   126 LCAYAFPN-------CHMEGGRAVKAPLCFEDCQATHLQFCYNDWVLIEEKKERNMFIKSRGHFR 183
             ....||:       |....|.  ..|.||........::|                       .
  Rat   220 -IPAKFPSKNLKMNYCRNPDGE--PRPWCFTTDPNKRWEYC-----------------------D 258

  Fly   184 LPNCSSLPHYNASMRRPNCSYIGLTELKESEVSYDCRNGNGRFYMGTMNVSKSGIPCQRWDTQYP 248
            :|.|::.|                   .....:|.|..|.|..|.||::|:.||..||||..|.|
  Rat   259 IPRCTTPP-------------------PPPGPTYQCLKGRGENYRGTVSVTASGKTCQRWSEQTP 304

  Fly   249 HKHFQPPLVFHQLLEGENYCRNAGGEEPHPWCYTVDESVRWQHCDIPMC-----PDYVDPNAVDL 308
            |:|.:.|..|......||||||..||.. |||||.|..:||::|:||.|     ||..|.:.:..
  Rat   305 HRHNRTPENFPCKNLEENYCRNPDGETA-PWCYTTDSQLRWEYCEIPSCGSSVSPDQSDSSVLPE 368

  Fly   309 NTPIKME 315
            .||:..|
  Rat   369 QTPVVQE 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308 22/155 (14%)
KR 217..299 CDD:214527 40/86 (47%)
PTKc_Musk 435..713 CDD:133181
Pkinase_Tyr 441..707 CDD:285015
PlgNP_445943.1 PAN_AP_HGF 33..97 CDD:238532
KR 101..183 CDD:214527 70/267 (26%)
KR 183..262 CDD:214527 22/132 (17%)
KR 273..354 CDD:214527 40/81 (49%)
KR 374..456 CDD:214527 1/2 (50%)
KR 480..562 CDD:214527
Tryp_SPc 581..805 CDD:214473
Tryp_SPc 582..807 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.