DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and CRK3

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_177210.1 Gene:CRK3 / 843390 AraportID:AT1G70530 Length:646 Species:Arabidopsis thaliana


Alignment Length:345 Identity:82/345 - (23%)
Similarity:147/345 - (42%) Gaps:78/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 NTSRETLGGNGNTNTLAKWGTIRSTATIHSNCVALTTVTNVSDAKGTKPNARLEKLEYPRGDIVY 443
            |:...|..|||..|.|   |.|   ..:.|:.||...:.:.:.....|.:|:.::.:...|.:..
plant   244 NSGNSTSDGNGGHNHL---GVI---LAVTSSVVAFVLLVSAAGFLLKKRHAKKQREKKQLGSLFM 302

  Fly   444 V-----------------------RSLGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDASDQM 485
            :                       ..||||..|.|::    |::.:.:  .||||.|..: :.|.
plant   303 LANKSNLCFSYENLERATDYFSDKNKLGQGGSGSVYK----GVLTNGK--TVAVKRLFFN-TKQW 360

  Fly   486 QMDFEREACLLAEFDHPNIVRLLGVCALGRPMCLLFEYMAPGDLSEFLRACSPYATHQAPTQDRL 550
            ...|..|..|:::.||.|:|:|||....|....|::||:|...|.::|..          .:|..
plant   361 VDHFFNEVNLISQVDHKNLVKLLGCSITGPESLLVYEYIANQSLHDYLFV----------RKDVQ 415

  Fly   551 QLNELHLLQMAANIAAGMLYLSER---KFVHRDLATRNCLINEHMAVKIADFGLSH-----KIYL 607
            .||.....::....|.||.||.|.   :.:|||:...|.|:.:....:||||||:.     |.::
plant   416 PLNWAKRFKIILGTAEGMAYLHEESNLRIIHRDIKLSNILLEDDFTPRIADFGLARLFPEDKTHI 480

  Fly   608 QDYYKGDENDFIPIRWMPLESILYNKFSLESDVWAYGICLWEVFSFALQPYFGLTHEEVIKYIKE 672
            .....|      .:.:|..|.::..|.:.::||:::|:.:.||          :|.:....::::
plant   481 STAIAG------TLGYMAPEYVVRGKLTEKADVYSFGVLMIEV----------ITGKRNNAFVQD 529

  Fly   673 -GNVLGCPDNTPLSVYALMR 691
             |::|       .||::|.|
plant   530 AGSIL-------QSVWSLYR 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 68/289 (24%)
Pkinase_Tyr 441..707 CDD:285015 67/283 (24%)
CRK3NP_177210.1 Stress-antifung 30..127 CDD:396296
Stress-antifung 157..237 CDD:396296
STKc_IRAK 329..593 CDD:270968 67/254 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.