DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and AT1G11050

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_172572.1 Gene:AT1G11050 / 837646 AraportID:AT1G11050 Length:625 Species:Arabidopsis thaliana


Alignment Length:367 Identity:79/367 - (21%)
Similarity:147/367 - (40%) Gaps:104/367 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 AVDLNTPI-KMEKFFTPSMIFLLAGIGFVAIVTLHLMILLVYKLSKHKDYSQPAGAATAECSVSM 368
            ::.|.:|: ..:|..|.::...:.|..|.|:|...| |.|.::..|               :|. 
plant   212 SLSLRSPLNSKKKRHTVALALGITGAIFGALVIAGL-ICLYFRFGK---------------AVK- 259

  Fly   369 RGGGDCGGNLNTSRETLGGNGNTNTLAKWGTIRSTATIHSNCVALTTVTNVSDAKGTKPNA---- 429
              ||:.|.....||            .||                            :||.    
plant   260 --GGEVGWEDQGSR------------PKW----------------------------RPNTGSIW 282

  Fly   430 -RLEKLEYPRGDIVYVRSLGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDASDQMQMDFEREA 493
             ::|:||....:......:|:|.||.|::    |::||..  ::|||.: .::..|...:|..|.
plant   283 FKIEELEKATNNFSQKNFIGRGGFGFVYK----GVLPDGS--VIAVKKV-IESEFQGDAEFRNEV 340

  Fly   494 CLLAEFDHPNIVRLLGVCAL-----GRPMCLLFEYMAPGDLSEFLRACSPYATHQAPTQD--RLQ 551
            .:::...|.|:|.|.| |::     .....|:::||:.|:|.:          |..|..:  ::.
plant   341 EIISNLKHRNLVPLRG-CSMVDDDSESQRYLVYDYMSNGNLDD----------HLFPRGETTKMP 394

  Fly   552 LNELHLLQMAANIAAGMLYLS---ERKFVHRDLATRNCLINEHMAVKIADFGLSH-----KIYLQ 608
            |:......:..::|.|:.||.   :....|||:...|.|::..|..::|||||:.     :.:|.
plant   395 LSWPQRKSIILDVAKGLAYLHYGVKPAIYHRDIKGTNILLDVDMRARVADFGLAKQSREGESHLT 459

  Fly   609 DYYKGDENDFIPIRWMPLESILYNKFSLESDVWAYGICLWEV 650
            ....|......|      |..||.:.:.:|||:::|:.:.|:
plant   460 TRVAGTHGYLAP------EYALYGQLTEKSDVYSFGVVILEI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 55/231 (24%)
Pkinase_Tyr 441..707 CDD:285015 54/225 (24%)
AT1G11050NP_172572.1 SPARK 21..184 CDD:408930
STKc_IRAK 301..581 CDD:270968 54/219 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.