DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and AT5G59270

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_001330782.1 Gene:AT5G59270 / 836045 AraportID:AT5G59270 Length:687 Species:Arabidopsis thaliana


Alignment Length:314 Identity:68/314 - (21%)
Similarity:118/314 - (37%) Gaps:94/314 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 RSLGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDASDQMQMDFEREACLLAEFDHPNIVRLLG 509
            |.||.|.||:|::...|      ....:|||.:..:|...|: .:..|...:....|.|:|:|||
plant   372 RLLGAGGFGKVYKGELP------SGTQIAVKRVYHNAEQGMK-QYAAEIASMGRLRHKNLVQLLG 429

  Fly   510 VCALGRPMCLLFEYMAPGDLSEFLRACSPYATHQAPTQDRLQLNEL---HLLQMAANIAAGMLYL 571
            .|.....:.|:::||..|.|.::|             .::.:|.:|   ..:.:...:|:.:|||
plant   430 YCRRKGELLLVYDYMPNGSLDDYL-------------FNKNKLKDLTWSQRVNIIKGVASALLYL 481

  Fly   572 S---ERKFVHRDLATRNCLINEHMAVKIADFGLSHKIYLQDYYKGDEN-----DFIPIRWMPLES 628
            .   |:..:|||:...|.|::..:..::.||||:.      ::...||     ....|.:|..|.
plant   482 HEEWEQVVLHRDIKASNILLDADLNGRLGDFGLAR------FHDRGENLQATRVVGTIGYMAPEL 540

  Fly   629 ILYNKFSLESDVWAYGICLWEVFSFALQPYFGLTHEEVIKYIKEGNVLGCPDNTPLSVYALM--- 690
            ......:.::|::|:|       ||.|:...|....|             ||..|..::.|.   
plant   541 TAMGVATTKTDIYAFG-------SFILEVVCGRRPVE-------------PDRPPEQMHLLKWVA 585

  Fly   691 ---RR----------------------------CWNRKPSERPGFAEINHCIQH 713
               :|                            |....|..||   .:.|.||:
plant   586 TCGKRDTLMDVVDSKLGDFKAKEAKLLLKLGMLCSQSNPESRP---SMRHIIQY 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 67/312 (21%)
Pkinase_Tyr 441..707 CDD:285015 65/306 (21%)
AT5G59270NP_001330782.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.