DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and AT5G10530

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_196615.1 Gene:AT5G10530 / 830918 AraportID:AT5G10530 Length:651 Species:Arabidopsis thaliana


Alignment Length:400 Identity:93/400 - (23%)
Similarity:149/400 - (37%) Gaps:101/400 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 TLGGNGNTNTLAKW----------------------------GTIRSTATIHSNCVALTTVTNVS 420
            |.||....|.|..|                            |.:..|..|.|..|.|.......
plant   235 TSGGVTEGNRLLSWEFSSSLELIDIKKSQNDKKGMIIGISVSGFVLLTFFITSLIVFLKRKQQKK 299

  Fly   421 DAKGTKP----NARLEKLEYPR-----------GDIVYVRSLGQGAFGRVFQARAPGLVPDQEDL 470
            .|:.|:.    |..||:...||           .:....|.||:|.||.|::.....|     |:
plant   300 KAEETENLTSINEDLERGAGPRKFTYKDLASAANNFADDRKLGEGGFGAVYRGYLNSL-----DM 359

  Fly   471 LVAVKMLKDDASDQMQMDFEREACLLAEFDHPNIVRLLGVCALGRPMCLLFEYMAPGDLSEFLRA 535
            :||:|... ..|.|.:.:|..|..:::...|.|:|:|:|.|.......:::|:|..|.|...|..
plant   360 MVAIKKFA-GGSKQGKREFVTEVKIISSLRHRNLVQLIGWCHEKDEFLMIYEFMPNGSLDAHLFG 423

  Fly   536 CSPY-ATHQAPTQDRLQLNELHLLQMAANIAAGMLYLS---ERKFVHRDLATRNCLINEHMAVKI 596
            ..|: |.|..             .::...:|:.:|||.   |:..||||:...|.:::.:...|:
plant   424 KKPHLAWHVR-------------CKITLGLASALLYLHEEWEQCVVHRDIKASNVMLDSNFNAKL 475

  Fly   597 ADFGLSHKIYLQDYYKGDENDFI--PIRWMPLESILYNKFSLESDVWAYGICLWEVFS------- 652
            .||||:.   |.|:..|.:...:  ...:|..|.|...:.|.||||:::|:...|:.:       
plant   476 GDFGLAR---LMDHELGPQTTGLAGTFGYMAPEYISTGRASKESDVYSFGVVTLEIVTGRKSVDR 537

  Fly   653 --FALQPYFGLTHE--------EVIKYIKEGNVLGCPDNTP---LSVYALMRRCW------NRKP 698
              ..::|...|..:        |||..|.|...:|..|...   |.:..|    |      |.:|
plant   538 RQGRVEPVTNLVEKMWDLYGKGEVITAIDEKLRIGGFDEKQAECLMIVGL----WCAHPDVNTRP 598

  Fly   699 SERPGFAEIN 708
            |.:.....:|
plant   599 SIKQAIQVLN 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 75/316 (24%)
Pkinase_Tyr 441..707 CDD:285015 73/297 (25%)
AT5G10530NP_196615.1 Lectin_legB 19..263 CDD:278564 6/27 (22%)
Pkinase 335..605 CDD:278497 73/295 (25%)
STKc_IRAK 341..608 CDD:270968 72/292 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.