DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and STY17

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_195303.2 Gene:STY17 / 829731 AraportID:AT4G35780 Length:570 Species:Arabidopsis thaliana


Alignment Length:319 Identity:89/319 - (27%)
Similarity:155/319 - (48%) Gaps:38/319 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 RSTATIHSNCVALTTVTNVSDAKGTKPNARLEKLEYPRGDIVYVRSLGQGAFGRVFQARAPGLVP 465
            :||..:...||.:.|       .||      ::.|.....:...:.:..|::|.:|:    |...
plant   265 KSTNELLPACVEIPT-------DGT------DEWEIDMKQLKIEKKVACGSYGELFR----GTYC 312

  Fly   466 DQEDLLVAVKMLKDD-ASDQMQMDFEREACLLAEFDHPNIVRLLGVCALGRPMCLLFEYMAPGDL 529
            .||   ||:|:||.: .:.:|..:|.:|..::.:..|.|:|:.:|.|.....:|::.|:|..|.:
plant   313 SQE---VAIKILKPERVNAEMLREFSQEVYIMRKVRHKNVVQFIGACTRSPNLCIVTEFMTRGSI 374

  Fly   530 SEFLRACSPYATHQAPTQDRLQLNELHLLQMAANIAAGMLYLSERKFVHRDLATRNCLINEHMAV 594
            .:||        |:.....::|    .||::|.:::.||.||.:...:||||.|.|.|::||..|
plant   375 YDFL--------HKHKGVFKIQ----SLLKVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVV 427

  Fly   595 KIADFGLSHKIYLQDYYKGDENDFIPIRWMPLESILYNKFSLESDVWAYGICLWEVFSFALQPYF 659
            |:||||::...........:...:   |||..|.|.:..:...:||::|.|.|||:.:..| ||.
plant   428 KVADFGVARVQTESGVMTAETGTY---RWMAPEVIEHKPYDHRADVFSYAIVLWELLTGEL-PYS 488

  Fly   660 GLTH-EEVIKYIKEGNVLGCPDNTPLSVYALMRRCWNRKPSERPGFAEINHCIQHSIAE 717
            .||. :..:..:::|.....|..|...:..|:.:||.:.|:.||.||||...:...|.|
plant   489 YLTPLQAAVGVVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEMLNQLIRE 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 80/279 (29%)
Pkinase_Tyr 441..707 CDD:285015 77/267 (29%)
STY17NP_195303.2 ACT_TyrKc 178..244 CDD:153200
STKc_MAP3K-like 301..541 CDD:270901 79/262 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.