DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and CRK23

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_194062.1 Gene:CRK23 / 828430 AraportID:AT4G23310 Length:830 Species:Arabidopsis thaliana


Alignment Length:342 Identity:91/342 - (26%)
Similarity:151/342 - (44%) Gaps:75/342 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 SMIFLLAGIGFVAIVTLHLMILLVYKLSKHKDYSQPAGAATAECSVSMRGGGDCGGNLNTSR--- 382
            |.:.::|.:  |:|..|.|:.:.|:.: :.|...:..||...               ||..|   
plant   429 SSVIIIAVV--VSITALLLLFVAVFSV-RTKRRKKMIGAIPL---------------LNVKRKDT 475

  Fly   383 ---ETLGGNGNTNTLAKWGTIRSTATIHSNCVALTTVTNVSDAKGTKPNARLEKLEYPRGDIVYV 444
               |.|..||::.|.|        .::..:..|:...||                     :.:.:
plant   476 EVTEPLAENGDSITTA--------GSLQFDFKAIVAATN---------------------NFLPI 511

  Fly   445 RSLGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDASDQMQMDFEREACLLAEFDHPNIVRLLG 509
            ..||||.||.|::...|..|.      ||||.| ...|.|.:.:||.|..::|:..|.|:|||||
plant   512 NKLGQGGFGEVYKGTFPSGVQ------VAVKRL-SKTSGQGEREFENEVVVVAKLQHRNLVRLLG 569

  Fly   510 VCALGRPMCLLFEYMAPGDLSEFLRACSPYATHQAPTQDRLQLNELHLLQMAANIAAGMLYL--- 571
            .|..|....|::|::....|..||          ..|..:.||:.....::...||.|:|||   
plant   570 YCLEGEEKILVYEFVHNKSLDYFL----------FDTTMKRQLDWTRRYKIIGGIARGILYLHQD 624

  Fly   572 SERKFVHRDLATRNCLINEHMAVKIADFGLSHKIYLQDYYKGDENDFI-PIRWMPLESILYNKFS 635
            |....:||||...|.|::..|..|:||||:: :|:..|..:.:....: ...:|..|..:|.:||
plant   625 SRLTIIHRDLKAGNILLDADMNPKVADFGMA-RIFGMDQTEANTRRVVGTYGYMAPEYAMYGQFS 688

  Fly   636 LESDVWAYGICLWEVFS 652
            ::|||:::|:.::|:.|
plant   689 MKSDVYSFGVLVFEIIS 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 69/222 (31%)
Pkinase_Tyr 441..707 CDD:285015 69/216 (32%)
CRK23NP_194062.1 Stress-antifung 33..129 CDD:279926
Stress-antifung 145..240 CDD:279926
Stress-antifung 258..350 CDD:279926
TyrKc 511..780 CDD:197581 69/213 (32%)
STKc_IRAK 514..781 CDD:270968 69/210 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.