DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and AT4G11900

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_192927.5 Gene:AT4G11900 / 826797 AraportID:AT4G11900 Length:849 Species:Arabidopsis thaliana


Alignment Length:292 Identity:75/292 - (25%)
Similarity:125/292 - (42%) Gaps:45/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 RSLGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDASDQMQMDFEREACLLAEFDHPNIVRLLG 509
            :.||:|.||.|::.:.|      ..:.||:|.|...:| |...:|:.|..|:.:..|.|:|||||
plant   541 KKLGEGGFGPVYKGKLP------NGMEVAIKRLSKKSS-QGLTEFKNEVVLIIKLQHKNLVRLLG 598

  Fly   510 VCALGRPMCLLFEYMAPGDLSEFLRACSPYATHQAPTQDRLQLNELH---LLQMAANIAAGMLYL 571
            .|..|....|::|||:...|...|             .|.|:..||.   .:::......|:.||
plant   599 YCVEGDEKLLIYEYMSNKSLDGLL-------------FDSLKSRELDWETRMKIVNGTTRGLQYL 650

  Fly   572 ---SERKFVHRDLATRNCLINEHMAVKIADFGLSHKIYLQDYYKGDENDFIPIRWMPLESILYNK 633
               |..:.:||||...|.|:::.|..||:|||.:.....:......:.......:|..|..|...
plant   651 HEYSRLRIIHRDLKASNILLDDEMNPKISDFGTARIFGCKQIDDSTQRIVGTFGYMSPEYALGGV 715

  Fly   634 FSLESDVWAYGICLWEVFSFALQPYFGLTHEE----VIKY-------IKEGNVLGCPDNTPLSVY 687
            .|.:||::::|:.|.|:.|......|  .|.:    :|.|       .|..:::..|.....|:.
plant   716 ISEKSDIYSFGVLLLEIISGKKATRF--VHNDQKHSLIAYEWESWCETKGVSIIDEPMCCSYSLE 778

  Fly   688 ALMR------RCWNRKPSERPGFAEINHCIQH 713
            ..||      .|....|.:||..::|.:.:.:
plant   779 EAMRCIHIALLCVQDHPKDRPMISQIVYMLSN 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 75/290 (26%)
Pkinase_Tyr 441..707 CDD:285015 74/284 (26%)
AT4G11900NP_192927.5 B_lectin 33..184 CDD:214519
B_lectin 78..207 CDD:279758
S_locus_glycop 238..346 CDD:279321
PAN_2 368..431 CDD:285476
Pkinase 537..805 CDD:278497 74/285 (26%)
STKc_IRAK 543..808 CDD:270968 75/286 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.