DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and CRK40

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_192366.1 Gene:CRK40 / 825789 AraportID:AT4G04570 Length:654 Species:Arabidopsis thaliana


Alignment Length:413 Identity:106/413 - (25%)
Similarity:164/413 - (39%) Gaps:118/413 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 ENYCRNAGGEEPHPWCYTVDESVRWQHCDIPMCPDYVDPNAVDLNT--------PIKMEKFFTPS 321
            ::|....||....|.||     .||   |:     |...||.|..|        |...||   .|
plant   226 KDYMGRKGGMASLPSCY-----FRW---DL-----YSFHNAFDNVTRVPAPPPRPHAQEK---ES 274

  Fly   322 MIFLLAG--IGF---VAIVTLHLMILLVYKLSKHKDYSQPAGAATAECSVSMRGGGDCGGNLNTS 381
            .|.:..|  ||:   :|||.:...|.|:..:...|.|::                   .|.||  
plant   275 CITVKKGKSIGYGGIIAIVVVFTFINLLVFIGFIKVYAR-------------------RGKLN-- 318

  Fly   382 RETLGGNGNTNTLAKWGTIRSTATIHSNCVALTTVTNVSDAKGTKPNARLEKLEYPRGDIVYV-- 444
                                                ||..|:.:..:.:. .|.:..|.||..  
plant   319 ------------------------------------NVGSAEYSDSDGQF-MLRFDLGMIVMATD 346

  Fly   445 -----RSLGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDASDQMQMDFEREACLLAEFDHPNI 504
                 .:||||.||.|::    |..|:.::  ||||.| ...|.|..|:|:.|..||....|.|:
plant   347 DFSSENTLGQGGFGTVYK----GTFPNGQE--VAVKRL-TKGSGQGDMEFKNEVSLLTRLQHKNL 404

  Fly   505 VRLLGVCALGRPMCLLFEYMAPGDLSEFLRACSPYATHQAPTQDRLQLNELHL-LQMAANIAAGM 568
            |:|||.|..|....|::|::....|..|:.           .:|:..|....: .::...||.|:
plant   405 VKLLGFCNEGDEEILVYEFVPNSSLDHFIF-----------DEDKRSLLTWEVRFRIIEGIARGL 458

  Fly   569 LYL---SERKFVHRDLATRNCLINEHMAVKIADFGLSHKIYLQDYYKGDENDFIPIR-WMPLESI 629
            |||   |:.|.:||||...|.|::..|..|:||||.: :::..|..:.:.......| :|..|.:
plant   459 LYLHEDSQLKIIHRDLKASNILLDAEMNPKVADFGTA-RLFDSDETRAETKRIAGTRGYMAPEYL 522

  Fly   630 LYNKFSLESDVWAYGICLWEVFS 652
            .:.:.|.:|||:::|:.|.|:.|
plant   523 NHGQISAKSDVYSFGVMLLEMIS 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527 9/33 (27%)
PTKc_Musk 435..713 CDD:133181 70/230 (30%)
Pkinase_Tyr 441..707 CDD:285015 69/224 (31%)
CRK40NP_192366.1 Stress-antifung 29..127 CDD:279926
Stress-antifung <189..249 CDD:279926 9/35 (26%)
S_TKc 348..606 CDD:214567 67/217 (31%)
STKc_IRAK 354..611 CDD:270968 67/211 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.