Sequence 1: | NP_477255.1 | Gene: | Nrk / 36445 | FlyBaseID: | FBgn0020391 | Length: | 724 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_191534.1 | Gene: | AT3G59750 / 825144 | AraportID: | AT3G59750 | Length: | 626 | Species: | Arabidopsis thaliana |
Alignment Length: | 207 | Identity: | 58/207 - (28%) |
---|---|---|---|
Similarity: | 101/207 - (48%) | Gaps: | 20/207 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 447 LGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDASDQMQMDFEREACLLAEFDHPNIVRLLGVC 511
Fly 512 ALGRPMCLLFEYMAPGDLSEFLRACSPYATHQAPTQDRLQLNELHLLQMAANIAAGMLYLSE--- 573
Fly 574 RKFVHRDLATRNCLINEHMAVKIADFGLSHKIYLQDYYKGDENDFIPIRWMPLESILYNKFSLES 638
Fly 639 DVWAYGICLWEV 650 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Nrk | NP_477255.1 | CRD_FZ | 67..212 | CDD:295308 | |
KR | 217..299 | CDD:214527 | |||
PTKc_Musk | 435..713 | CDD:133181 | 58/207 (28%) | ||
Pkinase_Tyr | 441..707 | CDD:285015 | 58/207 (28%) | ||
AT3G59750 | NP_191534.1 | lectin_legume_LecRK_Arcelin_ConA | 20..226 | CDD:173887 | |
S_TKc | 303..>502 | CDD:214567 | 58/207 (28%) | ||
PKc_like | 309..576 | CDD:304357 | 58/207 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 108 | 1.000 | Inparanoid score | I2087 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |