DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and AT3G53810

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_190949.1 Gene:AT3G53810 / 824548 AraportID:AT3G53810 Length:677 Species:Arabidopsis thaliana


Alignment Length:296 Identity:76/296 - (25%)
Similarity:126/296 - (42%) Gaps:44/296 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 LGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDASDQMQMDFEREACLLAEFDHPNIVRLLGVC 511
            ||.|.||||::    |::|..: |.||||.:..|:...|: :|..|...:....|.|:|.|||.|
plant   353 LGSGGFGRVYR----GILPTTK-LEVAVKRVSHDSKQGMK-EFVAEIVSIGRMSHRNLVPLLGYC 411

  Fly   512 ALGRPMCLLFEYMAPGDLSEFLRACSPYATHQAPTQDRLQLNELHLLQMAANIAAGMLYLS---E 573
            .....:.|:::||..|.|.::|      ..:...|.|..|.:.:     ...:|:|:.||.   |
plant   412 RRRGELLLVYDYMPNGSLDKYL------YNNPETTLDWKQRSTI-----IKGVASGLFYLHEEWE 465

  Fly   574 RKFVHRDLATRNCLINEHMAVKIADFGLSHKIYLQDYYKGDENDFI--PIRWMPLESILYNKFSL 636
            :..:|||:...|.|::.....::.||||:.   |.|:....:...:  .:.::..|.....:.:.
plant   466 QVVIHRDVKASNVLLDADFNGRLGDFGLAR---LYDHGSDPQTTHVVGTLGYLAPEHSRTGRATT 527

  Fly   637 ESDVWAYGICLWEV--------FSFALQPYFGLTHEEVIKYIKEGNVLGCPDNTPLS-------- 685
            .:||:|:|..|.||        |..|....| |..|.|......||::...|....|        
plant   528 TTDVYAFGAFLLEVVSGRRPIEFHSASDDTF-LLVEWVFSLWLRGNIMEAKDPKLGSSGYDLEEV 591

  Fly   686 --VYALMRRCWNRKPSERPGFAEINHCIQHSIAESE 719
              |..|...|.:..|..||...::...::..:|..|
plant   592 EMVLKLGLLCSHSDPRARPSMRQVLQYLRGDMALPE 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 74/288 (26%)
Pkinase_Tyr 441..707 CDD:285015 74/282 (26%)
AT3G53810NP_190949.1 Lectin_legB 25..276 CDD:278564
STYKc 348..619 CDD:214568 74/286 (26%)
STKc_IRAK 353..619 CDD:270968 74/286 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.