DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and AT2G43700

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_181898.1 Gene:AT2G43700 / 818972 AraportID:AT2G43700 Length:658 Species:Arabidopsis thaliana


Alignment Length:361 Identity:85/361 - (23%)
Similarity:141/361 - (39%) Gaps:95/361 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 VDPNAVDLNTPIKMEKFFTP-----SMIF---LLAGIGFVAIVTLHLMILLVYKLSKHKDYSQPA 357
            ||...:||..|.     |.|     |:::   |:..:..|..|.|....|.::...:||...:  
plant   253 VDVPNLDLGIPT-----FPPYPKEKSLVYRIVLVTSLALVLFVALVASALSIFFYRRHKKVKE-- 310

  Fly   358 GAATAECSVSMRGGGDCGGNLNTSRETLGGNGNTNTLAKWGTIRSTATIHSNCVALTTVTNVSDA 422
              ...|..:      .||.:....:|..                                     
plant   311 --VLEEWEI------QCGPHRFAYKELF------------------------------------- 330

  Fly   423 KGTKPNARLEKLEYPRGDIVYVRSLGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDASDQMQM 487
            |.||...:|               ||:|.||:||:...||     .|..:|||.:..|:...|| 
plant   331 KATKGFKQL---------------LGKGGFGQVFKGTLPG-----SDAEIAVKRISHDSKQGMQ- 374

  Fly   488 DFEREACLLAEFDHPNIVRLLGVCALGRPMCLLFEYMAPGDLSEFLRACSPYATHQAPTQDRLQL 552
            :|..|...:....|.|:|||.|.|.....:.|::::|..|.|.::|       .|:| .|::|..
plant   375 EFLAEISTIGRLRHQNLVRLQGYCRYKEELYLVYDFMPNGSLDKYL-------YHRA-NQEQLTW 431

  Fly   553 NELHLLQMAANIAAGMLYLSE---RKFVHRDLATRNCLINEHMAVKIADFGLSHKIYLQDYYKGD 614
            |:  ..::..:||:.:.||..   :..:|||:...|.||:..|..::.||||: |:|.|.|....
plant   432 NQ--RFKIIKDIASALCYLHHEWVQVVIHRDIKPANVLIDHQMNARLGDFGLA-KLYDQGYDPQT 493

  Fly   615 ENDFIPIRWMPLESILYNKFSLESDVWAYGICLWEV 650
            ........::..|.|...:.:..:||:|:|:.:.||
plant   494 SRVAGTFWYIAPELIRSGRATTGTDVYAFGLFMLEV 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 62/219 (28%)
Pkinase_Tyr 441..707 CDD:285015 62/213 (29%)
AT2G43700NP_181898.1 lectin_legume_LecRK_Arcelin_ConA 27..247 CDD:173887
PKc_like 340..605 CDD:304357 62/207 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.