DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and Hgfac

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_445772.1 Gene:Hgfac / 58947 RGDID:70909 Length:653 Species:Rattus norvegicus


Alignment Length:514 Identity:102/514 - (19%)
Similarity:158/514 - (30%) Gaps:186/514 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SGKVCK---EYLTGQVWYSLEDPTGGWKNEQVTTALWDELISDLTGLCREA-----AEKMLCAYA 130
            ||:.|:   .| .|::.:|.......::....||..:|.  ....|.|.||     ...:|...|
  Rat   101 SGQPCRFPFRY-GGRMLHSCSSEGSAYRKWCATTHNYDR--DRAWGYCAEATLPVEGPAVLDPCA 162

  Fly   131 FPNCHMEGGRA----------VKAPLCF--EDCQATHLQFCYND-----------WVLIEEKKER 172
            ...| :.||..          ...||.|  :||..   :.|:::           |..:.|    
  Rat   163 SGPC-LNGGTCSSTQDHVSYHCACPLAFTGKDCGT---EKCFDETRYEYFEVGDHWARVSE---- 219

  Fly   173 NMFIKSRGHFRLPNCSSL--------PHYNASMRRP-----NCSYI---GLTELKESEVSY---- 217
                   ||  :..||.:        .|:.|.:..|     .|..|   | |.:....:.|    
  Rat   220 -------GH--VEQCSCIEGQARCEDT
HHTACLSSPCLNGGTCHLIVGTG-TSICACPLGYAGRF 274

  Fly   218 -------DCRNGNGRFYMGTMNVSKSGIPCQRWDTQYPHKHFQPPLVFHQLLEG---ENYCRNAG 272
                   .|..|||..|.|..:.|.||:.|..|::...::......|....|.|   ..||||..
  Rat   275 CNIVPTERCFLGNGTEYRGVASTSASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPD 339

  Fly   273 GEEPHPWCYTV-DESVRWQHCDIPMC----------PDYVD--PNAVDLNTPI-----KMEKFFT 319
            .:| .||||.| |.::.|::|.:..|          |:.:.  |.:.....|.     |...|..
  Rat   340 KDE-RPWCYVVKDSALSWEYCRLAACESLARVHSRIPEVLATLPESTSTARPTCGKRHKKRTFLR 403

  Fly   320 PSMIFLLAGIGFVAIVTLHLMILLVYKLSKHKDYSQPAGAATAECSVSMRGGGDCGGNLNTSRET 384
            |.:|.     |..::...|..:..:|                       .|.|.|.|:|      
  Rat   404 PRIIG-----GSSSLPGSHPWLAAIY-----------------------IGNGFCAGSL------ 434

  Fly   385 LGGNGNTNTLAKWGTIRSTATIHSNCVALTTVTNVSDAKGTKPNARLEKLEYPRGDIVYVRSLGQ 449
                                 :|: |    .|.:.:....:.|         ||..|..|  |||
  Rat   435 ---------------------VHT-C----WVVSAAHCFSSSP---------PRDSITVV--LGQ 462

  Fly   450 GAFGRVFQARAPGLV-------------PDQEDLLVAVKMLKDDASDQMQMDFEREACL 495
            ..|.|.........:             |:..| ||.:::.|......::..|.:..||
  Rat   463 HFFNRTTDVTQTFAIEKYVPYTLYSVFNPNDHD-LVLIRLKKKGERCAVRSQFVQPICL 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308 37/184 (20%)
KR 217..299 CDD:214527 29/106 (27%)
PTKc_Musk 435..713 CDD:133181 17/74 (23%)
Pkinase_Tyr 441..707 CDD:285015 15/68 (22%)
HgfacNP_445772.1 FN2 99..145 CDD:128373 10/46 (22%)
EGF_CA 159..194 CDD:238011 7/35 (20%)
FN1 197..237 CDD:238018 7/52 (13%)
EGF 242..274 CDD:278437 6/32 (19%)
Kringle 283..364 CDD:278480 27/81 (33%)
Tryp_SPc 405..639 CDD:214473 30/188 (16%)
Tryp_SPc 406..641 CDD:238113 30/187 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.