DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and NTRK2

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_006171.2 Gene:NTRK2 / 4915 HGNCID:8032 Length:838 Species:Homo sapiens


Alignment Length:680 Identity:202/680 - (29%)
Similarity:310/680 - (45%) Gaps:139/680 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 AFPNCHMEGGRAVKAPLCFEDCQATHLQFCYNDWVLIEEKKERNMFIKSRGHFRLPNCSSLPHYN 194
            |.||..:|.|:::............::.:...:.|    .|..|....::|..|:.|.||    :
Human   202 AAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLV----SKHMNETSHTQGSLRITNISS----D 258

  Fly   195 ASMRRPNCSYIGLTELKESEVSYDCR-----------------------NGNGR-----FYMGTM 231
            .|.::.:|....|....:..|:....                       .||.:     ||.|.:
Human   259 DSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAI 323

  Fly   232 NVSKSGIPCQRWDTQYPHKHFQPPLVFHQLLEGENYCRNAGGEEPHPWCYTV--------DES-- 286
             :::|...|.:       .|......:|..|:.:|......|:      ||:        ||.  
Human   324 -LNESKYICTK-------IHVTNHTEYHGCLQLDNPTHMNNGD------YTLIAKNEYGKDEKQI 374

  Fly   287 ----VRWQHCDIPMCPDYVD-----------------------PNAVDLNTPIKMEKFFTPSMIF 324
                :.|...|....|:|.|                       | :.|:......|.....:::.
Human   375 SAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIP-STDVTDKTGREHLSVYAVVV 438

  Fly   325 LLAGIGFVAIVTLHLMILLVYKLSKH-----KDYS----------QPAGAATAECSVSMRGGGDC 374
            :.:.:||..:|.|.|:     ||::|     ||:|          |..|.|:.     :....|.
Human   439 IASVVGFCLLVMLFLL-----KLARHSKFGMKDFSWFGFGKVKSRQGVGPASV-----ISNDDDS 493

  Fly   375 GGNLNTSRETLGGNGNTNTLAKWGTIRSTATIHSNCVALTTVTNVSDAK-------GTKPNARLE 432
            ...|:    .:....||.:.::.|   ..|.|    :.:|.:..:.:.:       ..||:..::
Human   494 ASPLH----HISNGSNTPSSSEGG---PDAVI----IGMTKIPVIENPQYFGITNSQLKPDTFVQ 547

  Fly   433 KLEYPRGDIVYVRSLGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDASDQMQMDFEREACLLA 497
            .::  |.:||..|.||:||||:||.|....|.|:|:.:|||||.|| ||||..:.||.|||.||.
Human   548 HIK--RHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLK-DASDNARKDFHREAELLT 609

  Fly   498 EFDHPNIVRLLGVCALGRPMCLLFEYMAPGDLSEFLRACSPYATHQAPTQDRLQLNELHLLQMAA 562
            ...|.:||:..|||..|.|:.::||||..|||::||||..|.|...|......:|.:..:|.:|.
Human   610 NLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQ 674

  Fly   563 NIAAGMLYLSERKFVHRDLATRNCLINEHMAVKIADFGLSHKIYLQDYYKGDENDFIPIRWMPLE 627
            .|||||:||:.:.||||||||||||:.|::.|||.|||:|..:|..|||:...:..:||||||.|
Human   675 QIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPE 739

  Fly   628 SILYNKFSLESDVWAYGICLWEVFSFALQPYFGLTHEEVIKYIKEGNVLGCPDNTPLSVYALMRR 692
            ||:|.||:.|||||:.|:.|||:|::..||::.|::.|||:.|.:|.||..|...|..||.||..
Human   740 SIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLG 804

  Fly   693 CWNRKPSERPGFAEINHCIQHSIAESECKA 722
            ||.|:|..|.....|     |::.::..||
Human   805 CWQREPHMRKNIKGI-----HTLLQNLAKA 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308 16/81 (20%)
KR 217..299 CDD:214527 18/123 (15%)
PTKc_Musk 435..713 CDD:133181 134/277 (48%)
Pkinase_Tyr 441..707 CDD:285015 132/265 (50%)
NTRK2NP_006171.2 LRR_8 92..150 CDD:404697
LRR 1 92..113
LRR 2 116..137
TPKR_C2 152..195 CDD:407151
Ig 205..283 CDD:416386 15/85 (18%)
Ig strand A' 205..209 CDD:409353 1/3 (33%)
Ig strand B 212..221 CDD:409353 0/8 (0%)
Ig strand D 238..243 CDD:409353 2/4 (50%)
Ig strand E 244..254 CDD:409353 2/9 (22%)
Ig strand F 261..270 CDD:409353 1/8 (13%)
Ig strand G 273..283 CDD:409353 1/9 (11%)
IgI_TrkB_d5 286..379 CDD:409441 16/106 (15%)
Ig strand B 301..305 CDD:409441 0/3 (0%)
Ig strand C 314..318 CDD:409441 0/3 (0%)
Ig strand E 344..348 CDD:409441 1/3 (33%)
Ig strand F 358..363 CDD:409441 2/10 (20%)
Ig strand G 371..374 CDD:409441 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 491..514 5/29 (17%)
PTKc_TrkB 548..835 CDD:270675 137/290 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.