DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and Tie

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster


Alignment Length:396 Identity:110/396 - (27%)
Similarity:167/396 - (42%) Gaps:120/396 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 EYPRGDIVYVRSLGQGAFGRVFQARAPGLVPDQEDL--------LVAVKMLKDDASDQMQMDFER 491
            ::.|.:|.....||:|.||:|::|.|       :||        :||||.::   :...|:..:.
  Fly   848 DFERSNIRLKSLLGEGNFGQVWKAEA-------DDLSGHFGATRIVAVKTIR---ACSAQVSLKD 902

  Fly   492 EACLLAEF-DHPNIVRLLGVCALGRPMCLLFEYMAPGDLSEFLRACSPYATHQAPT-----QDRL 550
            ||.::.:. .|.|:|.|||.|....|..|:.||...|.|...|||... ||:..|.     :...
  Fly   903 EANIMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARS-ATNILPASVPGGRSLA 966

  Fly   551 QLNELHLLQMAANIAAGMLYLSERKFVHRDLATRNCLINEHMAVKIADFGLS------------- 602
            .|:...|...|.:||.||.|::.|:.||||||.||.|::.:...||.|||:|             
  Fly   967 PLSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQE 1031

  Fly   603 ------------HKI-------YLQDYYK------------------GDENDF-----------I 619
                        ||.       |:..:::                  |::...           :
  Fly  1032 KNAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHAL 1096

  Fly   620 PIRWMPLESILYNKFSLESDVWAYGICLWEVFSFALQPYFGLTHEEVIKYIKEGNVLGCPDNTPL 684
            |||||..||:.|:.|:.|:|:||:||.|||:.:....||..||..|||:.:.:|.....|..:..
  Fly  1097 PIRWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRH 1161

  Fly   685 SVYALMRRCWNRKPSERPGFA-------------------------------EINHCI---QHSI 715
            ..|.||.|||:::|..||.||                               ::.|.:   .|.|
  Fly  1162 EFYNLMSRCWHKEPHMRPSFAQSRLEITRSLHKWVDDDSAASDYMDVSGFSEDLEHGVVYFNHRI 1226

  Fly   716 AESECK 721
            :|.||:
  Fly  1227 SEFECE 1232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 105/386 (27%)
Pkinase_Tyr 441..707 CDD:285015 103/371 (28%)
TieNP_523928.1 TyrKc 854..1183 CDD:197581 102/339 (30%)
PTKc 860..1187 CDD:270623 102/337 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.