DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and Drl-2

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster


Alignment Length:356 Identity:99/356 - (27%)
Similarity:160/356 - (44%) Gaps:53/356 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 SQPAGAATAECSVSMRGGGDCGGNLNTSRETLGGNGNTNTLAKWGTIRSTATIHSNCVALTTVTN 418
            :||...:|.: |:...|.|:|     ||     |:|   :|:.:|.|.:.:||            
  Fly   319 TQPCSLSTPK-SIRSNGNGNC-----TS-----GSG---SLSLFGGIPTGSTI------------ 357

  Fly   419 VSDAKGTKPNARLEKL-EYPRGDIVYVRSLGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDAS 482
            ...:.|.|.|.||.:: ....|.:.|...:.:|.|||::..:.      .|.....||.:.|.||
  Fly   358 TMASHGEKGNQRLRRITSVQPGALSYEELVKEGTFGRIYAGKL------GESCEALVKTVIDGAS 416

  Fly   483 DQMQMDFEREACLLAEFDHPNIVR-LLGVCALGRPMCLLFEYMAPGDLSEFLRACSPYATHQAPT 546
            ........::|.||....|.:|:. ||....|..|..:.:.:.:.|:|..:|         |...
  Fly   417 LTQVACLLQDASLLIGVSHQHILAPLLANTELPGPPEIAYPHPSKGNLKMYL---------QKSR 472

  Fly   547 QDRLQLNELHLLQMAANIAAGMLYLSERKFVHRDLATRNCLINEHMAVKIADFGLSHKIYLQDYY 611
            :....|:...|::...:|..|:.||.....||:|:|||||.::|...|||.|..||..::..||.
  Fly   473 ESSTALSTRQLVEFGLHITKGLAYLHSLGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYD 537

  Fly   612 KGDENDFIPIRWMPLESILYNKFSLESDVWAYGICLWEVFSFALQPYFGLTHEEV-----IKYIK 671
            ...:|:..|::|:.|||:....::.:.||||.|:..||:.:.|..|     ||||     ..|:.
  Fly   538 CLGDNENRPLKWLSLESLQKRVYATQGDVWALGVTYWELVTLAQMP-----HEEVDIFELTNYLA 597

  Fly   672 EGNVLGCPDNTPLSVYALMRRCWNRKPSERP 702
            .|..|..|.|.|...:.:|..||:.:..:||
  Fly   598 AGFRLEQPVNCPDEFFTVMNCCWHCEAKQRP 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 78/274 (28%)
Pkinase_Tyr 441..707 CDD:285015 77/268 (29%)
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 78/276 (28%)
STYKc 389..637 CDD:214568 76/260 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.