DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and CG3277

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster


Alignment Length:351 Identity:107/351 - (30%)
Similarity:157/351 - (44%) Gaps:95/351 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 EYPRGDIVYVRSLGQGAFGRVFQARAPGLVPDQEDLLVAVKMLK-DDASDQMQMDFEREACLLAE 498
            |.|...|...|.||:||||:|.:|.|..|...:...:||||.|| :..:|::       |..|||
  Fly   420 EVPHSAIQIGRMLGEGAFGQVHEATAINLRRMRGTTIVAVKQLKPNPKADEV-------AEYLAE 477

  Fly   499 FD-------HPNIVRLLGVCALGRPMCLLFEYMAPGDLSEFLR-----------------ACSPY 539
            .:       |.|:|..||.|.:..|..::.||:..|:|..:||                 :|.|.
  Fly   478 IEMLKGVGTHHNVVSFLGCCTIKPPYLMIMEYVNKGNLLSYLRTVRKEASKLRNRNANYTSCRPI 542

  Fly   540 ATH------------------------QAPTQDR------------------------------- 549
            .|.                        :.|.:|.                               
  Fly   543 MTRTNSTSSPKSQSVNYIELKASSQTIEMPQEDSTAHMNGIRQPHPSFAETTYTIVEDEDAFEYI 607

  Fly   550 LQLNELHLLQMAANIAAGMLYLSERKFVHRDLATRNCLINEHMAVKIADFGLS-HKIYLQDYYKG 613
            |...|||  ..|..||.||.:|.|::..|||||.||.||:.:..:||:||||| |.||.....:.
  Fly   608 LDNKELH--NFALQIANGMRFLEEQEITHRDLAARNVLIDSNKTLKISDFGLSRHGIYTNTRTRK 670

  Fly   614 DENDFIPIRWMPLESILYNKFSLESDVWAYGICLWEVFSFALQPYFGLTHEEVIKYIKEGNVLGC 678
                 :|:||:.:|:|..|.:|.:||:||||:.|||:.:....||..::::|:|.::..||.|..
  Fly   671 -----LPLRWLSIEAIRENVYSSKSDIWAYGVVLWEIGTLGASPYPTISNDELIPFLMAGNRLER 730

  Fly   679 PDNTPLSVYALMRRCWNRKPSERPGF 704
            |:.....||.:|.:||..:|.|||.|
  Fly   731 PEICTPQVYTIMLQCWLEEPEERPTF 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 107/351 (30%)
Pkinase_Tyr 441..707 CDD:285015 105/345 (30%)
CG3277NP_608762.3 STYKc 426..763 CDD:214568 105/345 (30%)
PTKc 430..763 CDD:270623 104/341 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455313
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.