DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and HABP2

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:435 Identity:88/435 - (20%)
Similarity:137/435 - (31%) Gaps:155/435 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EENGYC------------APYSGKVCKEYLTGQVWYSLED-PTGGWKNEQVTTALWDELISDLTG 116
            |..|.|            ||:||..|:     :|..:.:| |.|                   .|
Human    83 EHGGDCLVHGSTFTCSCLAPFSGNKCQ-----KVQNTCKDNPCG-------------------RG 123

  Fly   117 LCREAAE----KMLC--AYAFPNCHMEGGRAVKAPLCFED-CQATHLQFCYNDWVLIEEKKERNM 174
            .|.....    :.:|  .|..|:|      :...|:|..: ||         :.......|.|:.
Human   124 QCLITQSPPYYRCVCKHPYTGPSC------SQVVPVCRPNPCQ---------NGATCSRHKRRSK 173

  Fly   175 FIKSRGHFRLPNCSSLPHYNASMRRPNCSYIGLTELKESEVSYDCRNGNGRFYMGTMNVSKSGIP 239
            |          .|:....:....    |. ||         |.||..|:|..|.|.||.:.:...
Human   174 F----------TCACPDQFKGKF----CE-IG---------SDDCYVGDGYSYRGKMNRTVNQHA 214

  Fly   240 CQRWDT----QYPHKHFQPPLVFHQLLEGENYCRNAGGEEPHPWCY--TVDESVRWQHCDIPMC- 297
            |..|::    |..:..|......|.:.| .|:|||...:| .|||:  ..::.|:|::||:..| 
Human   215 CLYWNSHLLLQENYNMFMEDAETHGIGE-HNFCRNPDADE-KPWCFIKVTNDKVKWEYCDVSACS 277

  Fly   298 -PDYVDPNAVDLNTPIKMEKFFTPSMIFLLAGIGFVAIVTLHL-MILLVYKLSKHKDYSQPAGAA 360
             .|...|.........|:..|         ...|...|....: .|...:|.:..|...|.:..:
Human   278 AQDVAYPEESPTEPSTKLPGF---------DSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQS 333

  Fly   361 TAECSVSMRGGGDCGGNLNTSRETLGGNGNTNTLAKWGTIRSTATIH-------SNCVALTT--- 415
            :...::||..|..|||                           |.||       ::|..:.|   
Human   334 SLPLTISMPQGHFCGG---------------------------ALIHPCWVLTAAHCTDIKTRHL 371

  Fly   416 --VTNVSDAKGT---KPNARLEKL----------EYPRGDIVYVR 445
              |....|.|..   :.:.|:||:          |.|..||..::
Human   372 KVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308 28/164 (17%)
KR 217..299 CDD:214527 27/89 (30%)
PTKc_Musk 435..713 CDD:133181 4/11 (36%)
Pkinase_Tyr 441..707 CDD:285015 1/5 (20%)
HABP2NP_004123.1 EGF 77..106 CDD:306513 6/22 (27%)
KR 191..277 CDD:238056 27/87 (31%)
Tryp_SPc 314..553 CDD:238113 25/130 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.