DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and Ntrk2

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:XP_008769647.1 Gene:Ntrk2 / 25054 RGDID:3213 Length:837 Species:Rattus norvegicus


Alignment Length:710 Identity:214/710 - (30%)
Similarity:320/710 - (45%) Gaps:154/710 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 DLTGLCREAAEKMLCAYAFPNCHMEGGRAVKAPLCFEDCQATHLQFC----------YNDWVLIE 167
            ||..|...:....|.....|||.:...|.....|..|:.::..:. |          |.| |...
  Rat   173 DLYCLNESSKNTPLANLQIPNCGLPSARLAAPNLTVEEGKSVTIS-CSVGGDPLPTLYWD-VGNL 235

  Fly   168 EKKERNMFIKSRGHFRLPNCSSLPHYNASMRRPNC----------SYIGLT----------ELKE 212
            ..|..|....::|..|:.|.||    :.|.::.:|          ..:.||          |...
  Rat   236 VSKHMNETSHTQGSLRITNISS----DDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPT 296

  Fly   213 SE----VSYDCRNGNGR-----FYMGTMNVSKSGIPCQRWDTQYPHKHFQPPLVFHQLLEGENYC 268
            |:    :.:..| ||.:     ||.|.: :::|...|.:       .|......:|..|:.:|..
  Rat   297 SDHHWCIPFTVR-GNPKPALQWFYNGAI-LNESKYICTK-------IHVTNHTEYHGCLQLDNPT 352

  Fly   269 RNAGGEEPHPWCYTV--------DESVRWQH------CDIPMCPDYVDPNAVDLNTPIKM----- 314
            ....|:      ||:        ||.....|      .|....|:|.:....|..||..:     
  Rat   353 HMNNGD------YTLMAKNEYGKDERQISAHFMGRPGVDYETNPNYPEVLYEDWTTPTDIGDTTN 411

  Fly   315 ----------------EKFFTPSMIFLLAGIGFVAIVTLHLMILLVYKLSKHKDYSQPAGAATAE 363
                            |.....:::.:.:.:||..:|     :||:.||::|..:...       
  Rat   412 KSNEIPSTDVADQTNREHLSVYAVVVIASVVGFCLLV-----MLLLLKLARHSKFGMK------- 464

  Fly   364 CSVSMRGGGDCGGNLNTSRETLG------------------GNG-NTNTLAKWGTIRSTATIHSN 409
             .||..|.|..     .||:.:|                  .|| ||.:.::.|   ..|.|   
  Rat   465 -DVSWFGIGKV-----KSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGG---PDAVI--- 517

  Fly   410 CVALTTVTNVSDAK-------GTKPNARLEKLEYPRGDIVYVRSLGQGAFGRVFQARAPGLVPDQ 467
             :.:|.:..:.:.:       ..||:..::.::  |.:||..|.||:||||:||.|....|.|:|
  Rat   518 -IGMTKIPVIENPQYFGITNSQLKPDTFVQHIK--RHNIVLKRELGEGAFGKVFLAECYNLCPEQ 579

  Fly   468 EDLLVAVKMLKDDASDQMQMDFEREACLLAEFDHPNIVRLLGVCALGRPMCLLFEYMAPGDLSEF 532
            :.:|||||.|| ||||..:.||.|||.||....|.:||:..|||..|.|:.::||||..|||::|
  Rat   580 DKILVAVKTLK-DASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKF 643

  Fly   533 LRACSPYATHQAPTQDRLQLNELHLLQMAANIAAGMLYLSERKFVHRDLATRNCLINEHMAVKIA 597
            |||..|.|...|......:|.:..:|.:|..|||||:||:.:.||||||||||||:.|::.|||.
  Rat   644 LRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIG 708

  Fly   598 DFGLSHKIYLQDYYKGDENDFIPIRWMPLESILYNKFSLESDVWAYGICLWEVFSFALQPYFGLT 662
            |||:|..:|..|||:...:..:||||||.|||:|.||:.|||||:.|:.|||:|::..||::.|:
  Rat   709 DFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLS 773

  Fly   663 HEEVIKYIKEGNVLGCPDNTPLSVYALMRRCWNRKPSERPGFAEINHCIQHSIAESECKA 722
            :.|||:.|.:|.||..|...|..||.||..||.|:|..|.....|     |::.::..||
  Rat   774 NNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHTRKNIKNI-----HTLLQNLAKA 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308 26/128 (20%)
KR 217..299 CDD:214527 19/100 (19%)
PTKc_Musk 435..713 CDD:133181 134/277 (48%)
Pkinase_Tyr 441..707 CDD:285015 132/265 (50%)
Ntrk2XP_008769647.1 LRR_8 92..150 CDD:404697
TPKR_C2 152..195 CDD:407151 6/21 (29%)
Ig 205..283 CDD:416386 16/83 (19%)
Ig strand A' 205..209 CDD:409353 1/3 (33%)
Ig strand B 212..221 CDD:409353 1/9 (11%)
Ig strand D 238..243 CDD:409353 2/4 (50%)
Ig strand E 244..254 CDD:409353 2/9 (22%)
Ig strand F 261..270 CDD:409353 1/8 (13%)
Ig strand G 273..283 CDD:409353 1/9 (11%)
IgI_TrkB_d5 286..379 CDD:409441 20/107 (19%)
Ig strand B 301..305 CDD:409441 0/3 (0%)
Ig strand C 314..318 CDD:409441 0/3 (0%)
Ig strand E 344..348 CDD:409441 1/3 (33%)
Ig strand F 358..363 CDD:409441 2/10 (20%)
Ig strand G 371..374 CDD:409441 1/2 (50%)
PTKc_TrkB 547..834 CDD:270675 137/290 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.