DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrk and Hgf

DIOPT Version :9

Sequence 1:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_058713.1 Gene:Hgf / 24446 RGDID:2794 Length:728 Species:Rattus norvegicus


Alignment Length:256 Identity:73/256 - (28%)
Similarity:101/256 - (39%) Gaps:62/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 REREENGYCAPYSGKVCKEYLTGQVWYSLEDPTGGWKNEQVTTALWDELISDLTGLCREAAEKML 126
            ::.:|| ||....|:      .|..|....:|...::            :.|:. .|.| .|.|.
  Rat   171 KDLQEN-YCRNPRGE------EGGPWCFTSNPEVRYE------------VCDIP-QCSE-VECMT 214

  Fly   127 C---AYAFPNCHMEGGRAVKAPLCFEDCQATHLQFCYNDWVLIEEKKERNMFIKSR--------G 180
            |   :|..|..|.|.|:.         ||.         |  .::...|:.|:..|        .
  Rat   215 CNGESYRGPMDHTESGKT---------CQR---------W--DQQTPHRHKFLPERYPDKGFDDN 259

  Fly   181 HFRLPNCSSLPH-YNASMRRP-------NCSYIGLTELKESEVSYDCRNGNGRFYMGTMNVSKSG 237
            :.|.|:....|. |......|       .|::..:.|......:.:|..|.|..|.||.|...:|
  Rat   260 YCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSAVNETDVPMETTECIKGQGEGYRGTTNTIWNG 324

  Fly   238 IPCQRWDTQYPHKHFQPPLVFHQLLEGENYCRNAGGEEPHPWCYTVDESVRWQHC-DIPMC 297
            |||||||:||||||...|..|......||||||..|.| .|||:|.|.::|..:| .||.|
  Rat   325 IPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDGAE-SPWCFTTDPNIRVGYCSQIPKC 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308 31/163 (19%)
KR 217..299 CDD:214527 41/82 (50%)
PTKc_Musk 435..713 CDD:133181
Pkinase_Tyr 441..707 CDD:285015
HgfNP_058713.1 PAN_APPLE 41..123 CDD:238074
KR 127..209 CDD:214527 10/57 (18%)
KR 211..289 CDD:214527 19/97 (20%)
KR 305..385 CDD:214527 41/81 (51%)
KR 389..471 CDD:238056
Tryp_SPc 495..719 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.