DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TppII and KEX2

DIOPT Version :9

Sequence 1:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster
Sequence 2:NP_014161.1 Gene:KEX2 / 855483 SGDID:S000005182 Length:814 Species:Saccharomyces cerevisiae


Alignment Length:392 Identity:73/392 - (18%)
Similarity:122/392 - (31%) Gaps:148/392 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 ILKENLDFELEMLNSYEKVYGDIKTSYDCILFPTADGWLTIVDTTEQGDLDQALRIGEYSRTHET 330
            |:.:.||:|.|          |:|.:: |     |:|.....|.|               ...:.
Yeast   173 IVDDGLDYENE----------DLKDNF-C-----AEGSWDFNDNT---------------NLPKP 206

  Fly   331 RNVDDFLSISVNVHDEGNVLEVVGMSSPHGTH-VSSIASGNHSSRDVDGVAPNAKIVSMTIGDGR 394
            |..||:                      |||. ...||:...::....||..||||..:.|..|.
Yeast   207 RLSDDY----------------------HGTRCAGEIAAKKGNNFCGVGVGYNAKISGIRILSGD 249

  Fly   395 LGSMETGTALVRAMTKVMELCRDGRRIDVINMSYGEHANWSNSGRIGELMNEVVNK--------- 450
            :.:.:...:|:..:..          .|:.:.|:|.    ::.||..:..:::|.|         
Yeast   250 ITTEDEAASLIYGLDV----------NDIYSCSWGP----ADDGRHLQGPSDLVKKALVKGVTEG 300

  Fly   451 ---YGVVWVASAGNHGPA--------------LCTVGT--PPDISQPSLIGVGAYVSPQMMEAEY 496
               .|.::|.::||.|..              ..|:|.  ..|:..|...|..|.::        
Yeast   301 RDSKGAIYVFASGNGGTRGDNCNYDGYTNSIYSITIGAIDHKDLHPPYSEGCSAVMA-------- 357

  Fly   497 AMREKLPGNVYTWTSRDPCIDGGQGVTVCAPGGAIASVPQFTMSKSQLMNGTSMAAPHVAGAVAL 561
                                     ||..:..|............|....|||.|||..||...|
Yeast   358 -------------------------VTYSSGSGEYIHSSDINGRCSNSHGGTSAAAPLAAGVYTL 397

  Fly   562 LIS---GLKQQNIEYSPYSIKRAISVTATKLGYVDPFAQG--------------HGLLNVEKAFE 609
            |:.   .|..::::|  .||..|:.:.....|.....|.|              |.|:.:.|.:|
Yeast   398 LLEANPNLTWRDVQY--LSILSAVGLEKNADGDWRDSAMGKKYSHRYGFGKIDAHKLIEMSKTWE 460

  Fly   610 HL 611
            ::
Yeast   461 NV 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796 66/354 (19%)
Peptidase_S8 331..600 CDD:278510 57/314 (18%)
TPPII 892..1073 CDD:289357
TPPII_N 1144..1257 CDD:289360
KEX2NP_014161.1 Peptidases_S8_Protein_convertases_Kexins_Fur in-lik 133..419 CDD:173789 65/347 (19%)
COG4935 463..653 CDD:227271 73/392 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.