DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TppII and RRT12

DIOPT Version :9

Sequence 1:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster
Sequence 2:NP_009974.1 Gene:RRT12 / 850412 SGDID:S000000641 Length:491 Species:Saccharomyces cerevisiae


Alignment Length:463 Identity:103/463 - (22%)
Similarity:172/463 - (37%) Gaps:131/463 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 TANASRKIVEFESQNPGEASKLPWDKKILKENLDFEL---EMLNSYEK----------VYGDIKT 290
            |.|.|:.:|....::|..|..:|        |..||.   :.:||.|.          .|.|::.
Yeast    62 TMNLSKNLVNKLKKSPLVADIVP--------NFRFEAFEGDSVNSAESSYTFNATAKYSYEDVEE 118

  Fly   291 SYDCILFPTADGWLTIVDTTEQ-----GDLDQALRIGEYSRTHETRNVDDFLSISVNVHDEG--- 347
            ..:....|.|...|..:....|     ||.|:......|...|:.:..|    ::..:.|.|   
Yeast   119 EQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQD----VNAYIMDTGIFA 179

  Fly   348 -------NVLEVV-------GMSSPHGTHVSSIASGNHSSRDVDGVAPNAKIVSMTI----GDGR 394
                   .|::.:       |..:.|||||:.:....     ..|.|....:|.:.:    |.|.
Yeast   180 DHPEFEDRVIQGIDLTKEGFGDQNGHGTHVAGLVGSK-----TYGAAKRVNLVEVKVLGKDGSGE 239

  Fly   395 LGSMETGTA-LVRAMTKVMELCRDGRRIDVINMSYGEH----ANWSNSGRIGELMNEVVNKYGVV 454
            ..::.:|.. :|...|||..  ..|::. |.|:|.|..    .|.:..|.|.|         |:|
Yeast   240 ASNVLSGLEFIVEHCTKVSR--PQGKKC-VANLSLGSFRSPIINMAVEGAIEE---------GIV 292

  Fly   455 WVASAGNH-------GPALCTVGTPPDISQPSLIGVGAYVSPQMMEAEYAMREKLPGNVYTWTSR 512
            :||:|||.       .||          |..::|.|||:.......|:::          .|   
Yeast   293 FVAAAGNFNLDAYWASPA----------SAENVITVGAFDDHIDTIAKFS----------NW--- 334

  Fly   513 DPCIDGGQGVTVCAPGGAIASVPQFTMSKSQLMNGTSMAAPHVAGAVALLIS-GLK----QQNIE 572
            .||      |.:.|||..|.|:.....:.:.:::||||:.|.|.|..|:|:| |::    .|.||
Yeast   335 GPC------VNIFAPGVEIESLSHLNYNDTLILSGTSMSTPIVTGVAAILLSKGIEPEMIAQEIE 393

  Fly   573 Y--------------SPYSIKRAISVTATKLGYVDPF-AQGHGLLNVEKAFEHLTEHRQSKDNML 622
            |              .|.:..:.:.....||.  ||: .:....||:|...:.|.|:..:....:
Yeast   394 YLSTRNVFHRRTLFFKPSTPNQILYNGVDKLD--DPYDDETFPRLNIEAIAKELEEYNATLQTPM 456

  Fly   623 RFSVRVGN 630
            ..:::.|:
Yeast   457 SENLQSGS 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796 93/419 (22%)
Peptidase_S8 331..600 CDD:278510 73/321 (23%)
TPPII 892..1073 CDD:289357
TPPII_N 1144..1257 CDD:289360
RRT12NP_009974.1 Peptidases_S8_PCSK9_ProteinaseK_like 130..398 CDD:173790 75/317 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.