DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TppII and rspo2

DIOPT Version :10

Sequence 1:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster
Sequence 2:NP_001268919.1 Gene:rspo2 / 566054 ZFINID:ZDB-GENE-060503-667 Length:248 Species:Danio rerio


Alignment Length:33 Identity:10/33 - (30%)
Similarity:17/33 - (51%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 HLTEHRQSKDNMLRFSVRVGN-NADKGIHLRQG 641
            |.|:.::.|.|..|..:|..| ::|....:|.|
Zfish   215 HRTKDQKKKSNKQRLRLRAQNQHSDHLASIRAG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796
TPPII 892..1077 CDD:463636
TPPII_N 1144..1257 CDD:403697
rspo2NP_001268919.1 Furin-like_2 43..144 CDD:464939
TSP1_spondin 148..201 CDD:480609
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.