DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TppII and PCSK4

DIOPT Version :9

Sequence 1:NP_725252.1 Gene:TppII / 36444 FlyBaseID:FBgn0020370 Length:1441 Species:Drosophila melanogaster
Sequence 2:XP_011526387.1 Gene:PCSK4 / 54760 HGNCID:8746 Length:782 Species:Homo sapiens


Alignment Length:603 Identity:125/603 - (20%)
Similarity:195/603 - (32%) Gaps:189/603 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 NTDPEKAVR-VGLKSFSDLLPS----KVRN-NIVAQAKLKHWDKPHK------TATANASRKIVE 248
            |.:.|:..| .|..:...:.|.    .:|: .:|.|:...||.  |:      ..|....:.|.:
Human    46 NREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLTPHWG--HRLHLKKNPKTRPGPKSIQQ 108

  Fly   249 FESQNP-----GEASKL-PWDKKILKENLDFELEMLNSYEKVYGDIKTSYDCILFPTADGW---- 303
            .|:..|     |....| .|          |:.:.|..      .:|.|   ::.|| |.|    
Human   109 EEAGRPRYGNHGACQGLVQW----------FQQQTLQR------RVKRS---VVVPT-DPWFSKQ 153

  Fly   304 ----------LTIVDTTEQGDLDQALRIG------EYSRTHETRNVDDFLSISVNVHD-EGNVLE 351
                      |:|:....||...|.:.:.      |........|.|...|...|.:| :.....
Human   154 WYMNSEAQPDLSILQAWSQGLSGQGIVVSVLDDGIEKDHPDLWANYDPLASYDFNDYDPDPQPRY 218

  Fly   352 VVGMSSPHGTHVSS--IASGNHSSRDVDGVAPNAKIVSMTIGDGRLGSMETGTALVRAMTKVMEL 414
            .....:.|||..:.  .|..|:....| |||.||:|..:.:.||      |.|.::.|.:    |
Human   219 TPSKENRHGTRCAGEVAAMANNGFCGV-GVAFNARIGGVRMLDG------TITDVIEAQS----L 272

  Fly   415 CRDGRRIDVINMSYGEHANWSNSGRIGELMNEVVNK--------YGVVWVASAGNHGPALCTVGT 471
            ....:.|.:.:.|:|...:.......|.|..|...:        .|.:::.::||.|........
Human   273 SLQPQHIHIYSASWGPEDDGRTVDGPGILTREAFRRGVTKGRGGLGTLFIWASGNGGLHYDNCNC 337

  Fly   472 PPDISQPSLIGVGAYVSPQMMEAEYAMREKLPGNVYTWTSRDPCIDGGQGVTVCAPGGAIASVPQ 536
            ....:....:.||:          ...:.::|     |.| :.|   ...:|.....| :|:.||
Human   338 DGYTNSIHTLSVGS----------TTQQGRVP-----WYS-EAC---ASTLTTTYSSG-VATDPQ 382

  Fly   537 FTMSK-----SQLMNGTSMAAPHVAGAVALLISGLKQQNIEYSPYSIKRAIS---VTATK----- 588
            ...:.     :....|||.:||..||.:||.        :|.:|:...|.:.   |.|:|     
Human   383 IVTTDLHHGCTDQHTGTSASAPLAAGMIALA--------LEANPFLTWRDMQHLVVRASKPAHLQ 439

  Fly   589 --------LGYVDPFAQGHGLLN----VEKAFEHLTEHRQSKDNMLRFSVRVGNNADKGIHLRQG 641
                    :|.......|:|||:    |:.|...|....|.|     .:|||.:....       
Human   440 AEDWRTNGVGRQVSHHYGYGLLDAGLLVDTARTWLPTQPQRK-----CAVRVQSRPTP------- 492

  Fly   642 VQRNSIDYNVYIEPIFYNDKEADPKDKFNFNVRL-----NLIASQPWVQCGAFLDLSY------- 694
                       |.|:.|          ...||..     |.|.|...||  |.|.|||       
Human   493 -----------ILPLIY----------IRENVSACAGLHNSIRSLEHVQ--AQLTLSYSRRGDLE 534

  Fly   695 -------GTRSIAVRVDP 705
                   ||||..|.:.|
Human   535 ISLTSPMGTRSTLVAIRP 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TppIINP_725252.1 Peptidases_S8_Tripeptidyl_Aminopeptidase_II 101..589 CDD:173796 91/462 (20%)
Peptidase_S8 331..600 CDD:278510 61/300 (20%)
TPPII 892..1073 CDD:289357
TPPII_N 1144..1257 CDD:289360
PCSK4XP_011526387.1 S8_pro-domain 37..140 CDD:293079 20/111 (18%)
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 145..434 CDD:173789 68/328 (21%)
Peptidase_S8 176..459 CDD:278510 63/321 (20%)
P_proprotein 516..602 CDD:279782 13/39 (33%)
FU 674..711 CDD:214589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.